KEGG   Hyphomicrobium nitrativorans: W911_01370Help
Entry
W911_01370        CDS       T02943                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
hni  Hyphomicrobium nitrativorans
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:hni00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    W911_01370
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    W911_01370
Transporters [BR:hni02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    W911_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(291902..292906)
Genome map
AA seq 334 aa AA seqDB search
MRSRAFPPDPAIPEQELYAMNAMPARPMLIDAASGAAPAEKPPNPPRAQEQTSQETKVLP
LKTSSNTYATRISSALREMAATVVPPLVVLAVMLLVWQLATDKPGASLPSPMKIWSEAND
LIVSPFFVYGPQDIGLGWRVLTSLERVAYGFGLAAIFGIALGAIIGQSVWAMRGLDPIFQ
VLRTVPPLAWLPISLAAFQDSGPSAVFVIFITAVWPVIINTAVGIRNIPQDYRNVAEVLR
LNPLEYFWRIMIPAAAPYIFTGLRIGIGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLS
DIVVALIYIGVVGFVLDRLVALIGRVATRGTANA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatcacgcgcctttccgcctgatcccgcgatccccgaacaggagctttatgcgatg
aacgcaatgcccgcacgccccatgctgatcgacgccgcatccggtgcggcacccgccgaa
aaaccgccgaacccgccaagggcccaagagcagacatcgcaggaaacgaaagtcctgccg
ctcaagacgtcgtccaacacatacgcgacgcgcatttcgtcggcgcttcgggagatggca
gccaccgtcgttccgccgctcgtcgtcctggcggtgatgctgctcgtctggcagctcgca
accgataaacccggcgcgagccttccctctccgatgaagatctggagcgaagccaacgat
ctcatcgtctccccgttcttcgtctatggcccgcaggatatcggcctcggttggcgggtt
ttgaccagccttgagcgtgtggcgtatggcttcggcctcgccgccattttcggcatcgcg
ctcggcgccatcatcggtcagagcgtctgggcgatgcgcggcctcgatccgatctttcag
gtgctgcgcacggtgccgcccctcgcgtggttgccgatctcgctggcggccttccaggac
agcggcccgtcggcggtgttcgtgatcttcatcaccgccgtctggccggtgatcatcaac
accgctgtcggcatccgcaacatcccccaggactatcgcaacgtcgccgaggtgctgcgc
ctcaacccgctcgaatacttctggcgcatcatgatcccggctgccgcgccctacatcttc
acgggcctccgtatcggcatcggcctctcgtggcttgcgatcgtcgccgccgagatgctg
accggcggcgtcggcatcggctttttcatctgggatgcgtggaactcgtcgcgcctctcc
gacatcgtcgtcgctctcatctacatcggcgtcgtcggcttcgtgctcgaccggctggtc
gctctcatcggccgcgtcgcgacgcgcggcacagccaacgcctga

DBGET integrated database retrieval system