KEGG   Haliangium ochraceum: Hoch_1367Help
Entry
Hoch_1367         CDS       T01103                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
hoh  Haliangium ochraceum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1813469..1832680
Genome map
AA seq 6403 aa AA seqDB search
MTDHLNASGHWTTLIELLRERAELDAGYTFLLDGEQREAKRSFAALDTHARRIAATLQRA
GAEGERAVLLYPPSLDYIDAFFGCLYGNVVAVPAYPPDPTRLQRTLPRLQAIVADAGASI
ILTTRAIQTMAKAISAFAPELADKQWIATDAIEPGAEDAWAAPAVSGDSTAFLQYTSGST
GRPKGVIVSHRNILANETMIQRGFETGPDSMGVGWLPLYHDMGLIGNVIQPLCAGFSIAL
MSPLDFLRRPMRWLQAVSRYRATVSGGPNFAYDLCVRKSTPEERAALDLSAWRVAFSGAE
RVRPETLKRFVDAFGPQGFRWQAFYPCYGLAEATLLVTGGRRDAMPVVHEFHTGALEAGR
AEDEIIPSTGQALVGVGGAVEGPEPIVVDPETRTRVPERAIGEIWVQGPHVAGGYWGCPE
ESERVFRARLAEDDGAVYLRTGDLGFLRAGELYITGRLKDLIILRGRNLFPDDIERALES
SHDAIRPGCCAAFAVERQGEERLVVALELARGAEGQVDEVARAVRAAVASQLDVQVHTVA
LLRAGTIPKTSSGKIQRHACRQGFLAGSLELLAPAGADAQAEEGGGASTADERAGSGSGE
GAGDGSVDGPGDVDAERLCAVVARVLDRPREQITPQMSAVALGVDSLGAVELAYEIERHF
GVPVPGTLFLRDVSLAALAEELAAQSTGAAMPELAELSADAPGVSHNQASLLFLQELEPS
STAYNVCAAFRIRSQVDDDALAAAFTALVRRHPILRTRYQRGADGFTAVLDEAARVALRV
VDAPDADSEATRALVAEDALRPFDLQAEPVLRVSLFRHEPRLHTLSVTVHHVAVDYWSLV
LLMSELGELYQAARSGAELDDALPPASVHYAQFAAWQRALLEGPEGERLADFWAAELAET
RPPLDLGRPRRSPGAGRGGMHTFILDRELGAGLRRLAEAAGVTPYTVLLAGFQVLLSRYA
GQQQFVVGTPALGRTHHALDRTVGYFVNLLPIAAELSDAPSVRALLARVRDTVVRALEHQ
AYPFARMVEGRGGDRQSGRMPLVQAAFVFEKPHLQADAALSAVAFGQPGARAELGGMALE
PVSPAQRADLVTSPQFELLLQVFDSGEEMIGQASYDADLFDEEQVARMCGHFEAVLRAMV
ADVEQPAAAVSLLAADERAQVVEEWNATAVDYGAAQALHELVEAQVARTPEQVAVVFGER
SLSYRELDGWANRVARELRGRGVGVDARVGVYMERSLELMVALLAIAKAGGAYVPLEPTH
PAARVAHLVQDTGALLVLAQGPVPGEVCAADKVLVVDAELGAGQAETALGVAVPPEALAY
VLYTSGSTGQPKGVMNSHAGISNRLRWMQAEYELGGEDVVLQKTPFTFDVSVWEFFWPLM
TGARLVLAAPGKHTDAAYLSAVIGEHGVSTMHFVPSMLALFLRDAELAACQGLERVICSG
EALSAELCQQTQAALPNAGLHNLYGPTEAAVDVSFWDCGANSDGRPVPIGRPVANTTLYV
LDAAMQPQPVGVPGELYIGGVQVARGYQGQPARTAERFVPDPFASTPGGRLYRTGDRARL
RGDGAIEYLGRLDHQVKLRGVRIELGEVEAALQAVAGVDQAVAVVREDVLGEPSLVAYVV
AATAAEAEAAAELTPGALREALRARLPEAMVPGPIVFVPALPLTASGKLDRKALPRPEAP
TSAEGDADAAPRTATERALAELWQELLGADRVGVNDDFFQLGGHSLLAAQLIARVRRAFD
VELPLRAIFDAPTVAALAARLASASKALAPAAIPQIARDGELPLSFGQERLWFLDQLGSG
TAYNMGAALRLRGRLNADALARALQEVVQRHEVLRTSFPAADGRPRPSIAATAELTLAHL
DLRGESGDMDQRLAALAEAHAAERFDLARGPLLRASLVRTGEDEHVLLFVMHHITSDGWS
LRVLGRELGALYAAFAAGQASPLPPLPIQYADYAAWQRAALASDSARQQLAYWRQTLAEV
PGALELPTTERVRPAVQSYRGRVVHARVSEELGQALRELSRERGVTLFMTLMAGFQVLLS
RYAGQQRFAVGTPVANRAHGDLEQLIGFFVNSLALPADLVPASPDQALTCAALLARVRDA
AVGAYAHQEVPFEKVVEVLGVERDPSRSPVFQVMLSYEPAARLELALPGIEAEELAFPTG
DAKLDMTWLMSDGGAGALQLMVEYNADLFDEEQVARMCGHFEAVLRAMVADVEQPAAAVS
LLAADERAQVVEEWNATAVDYGAAQALHELVEAQVARTPEQVAVVFEGRSLSYRELDGWA
NRVARELRARGVGVDVRVGVYMERSLELMVALLAIAKAGGAYVPLEPTHPAARVAHLVQD
TGALLVLAQGPVPGEVCAADKVLVVDAELGAGQAETALGVAVPPEALAYVLYTSGSTGQP
KGVMNSHAGISNRLRWMQAEYELGGEDVVLQKTPFTFDVSVWEFFWPLMTGARLVLAAPG
KHTDAAYLSAVIGEHGVSTMHFVPSMLALFLRDAELAACQGLERVICSGEALSAELCQQT
QAALPNAGLHNLYGPTEAAVDVSFWDCGSNSDGRPVPIGRPVANTTLYVLDAAMQPQPVG
VPGELYIGGVQVARGYQGQPARTAERFVPDPFASTPGGRLYRTGDRARLRGDGAIEYLGR
LDHQVKLRGVRIELGEVEAALQAVAGVDQAVAVVREDVLGEPSLVAYVVAEAATEAETAA
ELSPGALREALRARLPEAMVPGPIVFLAALPLTASGKLDREALPRPEAPTSAESDADAAP
RTASERALAELWQELLGADRVGVNDDFFQLGGHSLLAAQLVARVRRAFEIELPIAALFTA
PTVAALARHIDDIRAERAASGHAERDWPSMPPLAPRAEAGPIPLSYEQERLWFLQQLYPS
SPAYNMFGAVRMHGPLDGDAFARALDEVVCRHESLRTTIDAPLGPPRQVVHEHQPAPLQL
IDLSHHGDPQSALAQRIQREAQQPFDLERGPLLRVRLVRERADSHVLLVCMHHIISDGWS
IGVFVRELAALYDAYAADQTAKLPELRVQYADYAVWQRAWLTGEVLAQQMQFWRDQLAGI
PTALELPTDYPRPSAPSFRGARHRFTIAPALSQAVADFSQQRGVTRFTTLMAAFATLLHR
YAGQRDIAVGTPVANRPEVETEQLIGFFANSLVLRTRFDDDPTVAELIAQVHRTSLDALA
HQQVPFAQLVAELQPNRDTSLSPLFQVMFGLQNTPAAPAALTGLRWQPIEVDEQSTSFDL
SLMLEEHDGGFRGTLDYSSDLFAPATMERFAAHLLRLLGDMLARPHARVSQLALLADWER
ERLAEWNDNRVEHRITGLVHDLFDEQVQATPDAIAVTYEGARLSYAELDRRANRVAHRLI
AMGVRPEHRVAICLPTSLEVIVGSLGIVKSGGVVLPLDPDYPQERLELLLSESDARVVIG
DARVRALLAAASTSGLAALPFVDIADLGPAAAQDDASWERAPATSVHPDNAVYLFYTSGS
TGKPKGVLVTHRGIANELAAERLTYGLRPGQGVLMATSVSFDMSLSQIYPPLIQGATLVI
ARPMSTEDASYLLRLIRDENVVLASFVPSLLAVLMDDPAFDECRNLGHIQACGEALLPEL
VQRFYGRTPATLWNCYGPTEVSIGITIGEVPRQLEATQGTAVTIGGPIPNIQAYVLDEHL
QPLPIGVPGELYLGGVGLARGYLNAPGRTAQSFVPDPFASAPGQRMYRTGDLARFREDGN
LECLGRVDDQVKVRGYRIELGEVESVLGQHASVREAVAAAFDRGDGNKILVAYVEPREQQ
DIDMAALRRYLGGRLPSYMVPTRIVQMDEMPRSASGKINRRALPAPELGHSDRAYVAPRS
AVEITLAQLWAALLGAERVGLEDDFFEFGGHSLLATQLVSRVRATFGIEIPLRALFETRT
LAAFAREVERHANIGPRVAPPVTPVSREGELVLSFGQERLWVLDQLDRSTAYNMPGAIRL
SGRLEHRALERALDEMVRRHESLRTVFEGRDGRPVQRILPPFTLALPVLDLRGHADREQR
ALGYIHEVVEEPFDLARGPLVRGALVHVEPDEHVLVFAMHHIVSDGWSLAVFARELGALY
AAYAAGQPSPLAEPAIQYADYAAWQRAWLDQERVEEQLAYWKQQLAGAPAALELPLDRPR
PPRQSFRGAYLTRPISNALSEAVAELARREGATLFMTLLAAFQSLLARYAGQDDVVVGTP
IANRRQQETEELIGFFVNTLALRTDVAGEPSFRELLARVRDVTLGAYANQDLPFERLVDE
LLPQRDLSRSPIFQVLFAVQNTPWEPLVLSDIALSHVDVEPNTAKFDIELSVVETETGLL
ATYNYCTDLFDERTIERMHGHLVNLLRAVVADPEQSIASVSLLDAAEQQTVVLDWNQTRA
PLPGQCVHHAVLARAAAQPEAIALRHGDQQLSYAELRARAGRLARHLRSLGVGVDEPVAL
YVHRSFDMIVGLLGILEAGACCVPLDPAYPQQRIEFILGDSRARVVVTQEPLAELLPAGA
PQSVRLDRDAAALAGPDSDSDGDALEVAVSLENLVYLIYTSGSTGKPKGVAMTHAALANL
MDWQARESSAGAGRTLQFAPLSFDVSFQEVFSTLGQGGTLVLVDEDTRRDFRALLQLIDE
QSVNRVFMPFVALRGIAEVARGQRLPPALREVITAGEQLQITPALEALFATDEAADGERA
PRVLVNQYGPSETHVATSYTLSGPPDRWPRLPPIGAPVANARAYVLDSAMHPVPVGVSGE
LYLGGTCVARGYLERPGLTAERFVPDPFADADAPGARLYRTGDLARYRADGAIEFLGRVD
RQAKIRGYRVELGEVETALGAHPAIADAAVLAREDASGAKRLIAYLVARPGESVDVRQLA
DALGSALPEYMVPSAFVLMHALPLTPSGKVAHALLPPPEMARDEDDEEFVAPRAGMEERL
AAVWRELLEMDGIGARDNFFELGGHSLLATQLMARVLRDTGVDLPPRTVFEAPTIEELAA
LVDAALPAAQASETEVEAETGQVSGEVSGQVSGQVSEIDPESAAAAPAAGGRFVTQRGHT
GDVPLAFAQERLWFLDQLEPSAAYNLVGAFRMSGSLSLPALAHALSGVVHRHEILRTTFP
AVDGQPVQRIASALVLPLPVFDLSAAAEPRAEVARQLAEEAGTRFDLARGPVLRVRLLRT
GEREHVLIFAMHHIVADGWSMSILAREVAALYEAHLRDRESALPPLPIQFADYALWERAH
LQGQVIDEHIAYWRQALAGAPTALELPTDRPRPAMQTSAGAHLSFEVPAELSARLRALGS
EHGCTLFMTVLAAFQVLLARCAGQDDVLVGAPVANRNRAEAEGLIGCFINTMVVRGRLSE
NPRFRDFLAQVRETTLGAQAHRAAPFALVVDALDLPRDLSRSPLFQVMFALHNLPPDRLE
LPGLTLEPVQDEMPFARFDLALDLWESRAGLRGSMEYNTALFDEATIARLCAQLSHVLAA
VVAAPDTPVADIPLMPREASLRQLAQWNDSARAVDFELSITARIAAQAERQPQATALACG
AQELSYGALIARVRQLAHALRGMGVGPERLVGVYLERSIDMVVAVLAVLEAGGAYLPLDP
AYPGERLAYMIADSGLALLLTQGSLRASLPPQRGRAVCLDDDDTRALVAQQPSAALAPAA
GADHLAYVIYTSGSTGQPKGVEVLRRGLRNLIPTLGQQLGMSADDVLVSATSLSFDIAML
ELFMSLAAGARLVLASRQVAGDGVALRALLRDSGATVFQATPATWRLLSEAGRSAADGRL
RVAVSGGEAMSEALARELAASADAVWNVYGPTETTIWSTGCRVDGAAAITIGQPLANTRA
YVLDQRREPVPVGVLGELYLGGEGVARGYLGRPALTAERFVPDPFARAPGARLYRTGDRV
RWQADGSLVFLGRVDHQVKVRGHRIELGEIETCLARHPAVQHAVVVVRQVQGEPQLVAYF
TRRERAEADADALAPAEARDFLRATLPEYMVPSTYVALDELPLTGSRKVDRRALPEPEQH
GVARAHVAPRPGLESELAALWCEVLGCEQLGADDDFFERGGHSLLAVRLLAAMKQRVGIE
LPVATLFQASTVARLAAAVERARTGSAPGAVLVPLASRGAGAPFFCVHLIGGDVVCYAGL
ARALDGRPFRALRAPGLDPESEPVASIEALAARYIAELRTVQAQGPYLLGGWSFGGLVAL
EMARQLAAQGHAVARVALLDTHPPSGDAPVDADAARRMFVADLIGLYGDPARVAPDDEHL
AGLDDMAAAVRHLQALGALPAELEIADLSRRLRVFQAHLAAEHGYRPVAYDGPVTLLRAA
QALPESHAGEAGDLAERWRAAGVRALAERTVPGDHFTMLAPAHAVELGRILSACLADADA
HASAVGAGAGEGAGEGAGEGAGEGAGEGEGGASAGTSSRRKTI
NT seq 19212 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcatctgaacgcgagtggacactggaccacgctcatcgagttgctgcgcgag
cgcgccgagctcgatgccggctacaccttcttgctcgacggcgagcagcgcgaagcgaag
cgcagtttcgccgcgctcgatacccacgcccggcgcatcgcggcgacgctgcagcgcgcg
ggggccgagggcgagcgcgcggtgctgctgtacccgcccagtctcgactacatcgacgcg
tttttcggatgcttgtacggaaacgtcgtcgcggtgccggcgtatccgcctgatcccacg
cgtttgcagcgcacgctgccgcgtctgcaggcgatcgtggccgacgctggcgccagcatc
atcctcaccacccgcgccatccagaccatggcgaaggcgatctcggcgttcgcgccggag
ctggccgacaagcagtggatcgccaccgacgcgatcgagccgggcgcggaggacgcgtgg
gcggcgcccgcggtgagcggcgattcgaccgcgttcctgcagtacacctcggggtccacg
gggcggcccaagggcgtgatcgtcagccaccgcaacatcctggccaacgagacgatgatt
cagcgcggtttcgagaccgggccggactcgatgggcgtgggctggctgccgctgtatcac
gacatggggctcatcgggaacgtgatccagccgctgtgcgcgggcttctccatcgccctg
atgtcgccgctggatttcctgcggcggcccatgcgctggctgcaggcggtgtcgcgctac
cgggccacggtgagcggcggccccaacttcgcctacgacctgtgcgtgcgcaagagtacg
cccgaggagcgggcggcgctggatctgagcgcctggcgggtggcgtttagcggcgctgag
cgggtgcggccggagacgctcaagcgcttcgtcgacgcctttggcccccagggcttccgc
tggcaggcgttttatccctgctacgggctggccgaggccacgctgctggtaaccggcggg
cgccgcgacgccatgccggtggtgcacgagttccacaccggcgcgctcgaggccggccgc
gccgaggacgagatcatcccctccaccgggcaggccttggtcggcgtcggcggcgcggtc
gaagggcccgagccgatcgtggtggatccggagacgcgcacgcgcgtgcccgagcgcgcc
atcggcgagatctgggtgcaggggccgcacgtggccggcggctactggggctgccccgag
gagagcgagcgcgtgttccgggcgcggctggccgaggacgacggcgccgtgtacctgcgc
acgggcgatctcggcttcctgcgcgcgggcgagctgtacatcaccgggcggctcaaggac
ctgatcatcctgcgcggccgcaacctgttccccgacgatatcgagcgcgcgctcgagtcc
agtcacgacgcgatccggccgggttgctgcgcggcctttgcggtcgagcggcagggcgag
gagcggctggtggtcgcgctcgagctggcgcgcggggccgagggccaggtcgatgaggtg
gcgcgcgcggtccgcgcggcggtggcctcgcagctcgatgtccaggtgcacacggtggcg
ctgctgcgcgccggcacgatccccaagacctcgagcggcaagatccagcgccacgcctgc
cggcagggcttcctggccggctcgctggagctgctggcgcccgcgggcgcggacgcgcag
gccgaggagggcggcggcgcaagcacggccgacgagcgcgcggggagcgggtctggcgag
ggcgccggcgatgggtctgttgacgggcctggcgatgtcgatgccgagcggctgtgtgcc
gtggtggcccgcgtcctggaccggccgcgcgagcagatcacgccgcagatgtcggcggtg
gcgctgggcgtggactcgctcggcgcggtcgagctggcgtacgagatcgagcggcacttt
ggcgtgcccgtgcccgggacgctgttcttgcgcgatgtttcgctggcggcgctggccgag
gagctggcggcccagagcacgggtgcggccatgcccgagctcgccgagctgagcgcggac
gcgcccggggtctcgcacaaccaggcctcgctgctgttcctgcaggagctggagccgtcg
agcacggcgtacaacgtctgcgccgccttccgcatccgctcgcaggtggacgacgacgcg
ctcgcggccgcgttcacggcgctggtgcgccgtcaccccatcctgcgcacccgctaccag
cgcggcgcggacggcttcacggccgtgctcgatgaggccgcgcgcgtggccctgcgggtg
gtggacgcgcccgacgcggacagcgaggccacccgcgcgctggtggccgaggacgcgctg
cgccccttcgatctccaggccgagccggtgctgcgcgtgagtctgttccgccacgagccg
cggctgcacacgctgtcggtgaccgtgcaccacgtggccgtggactactggtcgctggtg
ttgctgatgagcgagctgggcgagctgtaccaggcggcgcgcagcggcgcggagctggac
gacgcgctgccgccggcgagcgtgcactacgcgcagttcgcggcctggcagcgggccctg
ctcgaggggccggaaggcgagcgcctggccgatttctgggccgccgagctggcggagacg
cggccgcccctggacctgggccggccgcgccgctcgccgggcgccgggcgcggcggcatg
cacaccttcatcctggaccgcgagctgggggccgggctccggcgcctggccgaggcggcc
ggggtgacgccgtacaccgtgctcctggccgggtttcaggtgttgctgtcgcgctacgcc
gggcagcagcagttcgtggtcggcacgcccgcgctcggtcgcacgcaccacgcgctcgac
cggaccgtgggctacttcgtcaacctgctgccgatcgcggcggagctgtcggacgcgccc
tcggtgcgcgcgctgctcgcccgcgtgcgcgataccgtggtgcgcgcgctcgagcaccag
gcgtatcccttcgcgcgcatggtcgaggggcgcggcggcgaccggcagtccggccggatg
ccgctggtgcaggcggcctttgtgttcgagaaaccacacctgcaagcggacgcggcgctc
tcagccgtggcctttggtcagcccggggcccgcgccgagctcggcggcatggcgctcgag
ccggtgtccccggcgcagcgcgcggacctggtcaccagcccgcagttcgagctgctgctg
caggtgttcgacagcggcgaggagatgatcggacaggcgtcctacgacgccgacctgttc
gacgaagagcaggtggcgcgcatgtgcggccacttcgaggcggtgctgcgggcgatggtg
gcagacgtggagcagccggcggcggcggtgtcgctgctggcggcggacgagcgcgcgcag
gtggtggaggagtggaacgcgacggccgtggactacggggcggcgcaggcgctgcacgag
ctggtggaggcgcaggtggcgcgcacgcccgagcaggtggcggtggtgttcggggagcgc
tcgctgagctaccgggagctggacgggtgggcgaatcgcgtggcgcgggagctgcggggg
cggggcgtgggcgtggacgcgcgggtgggcgtgtacatggagcgctcgctggagttgatg
gtggcgctgctggcgatcgcgaaggcgggcggggcgtacgtgccgctggagccgacgcat
ccggcggcgcgagtggcgcacctagtgcaggacaccggggcgctgctggtgctggcgcag
gggccggtgcccggggaggtgtgcgcggcggacaaggtgctggtggtggacgccgagctg
ggggccgggcaggcggagacggcgctgggtgtggcggtgccgccggaggcgctggcgtac
gtgctctacacctcggggtcgacggggcagcccaagggggtgatgaacagccacgcgggc
atcagcaaccggctgcgctggatgcaggcggagtacgagctgggcggcgaggacgtggtc
ttgcagaagacgccctttaccttcgacgtgtcggtgtgggagttcttctggcccttgatg
acgggcgcgcggctggtgctggcggcgcccggcaagcacacggacgcggcgtacctgagc
gccgtgatcggcgagcacggggtgagcacgatgcacttcgtgccctcgatgctggcgctg
tttttgcgcgacgcggagctggcggcgtgccaggggctggagcgcgtgatctgcagcggt
gaggcgctgagcgcggagctgtgccagcagacgcaggcggcgctgccgaacgcggggctg
cacaacctctacggcccgaccgaggcggcggtggacgtgagtttctgggactgcggggcg
aattcggacggtcgtccggtgccgatcggtcgcccggtggccaacaccacgctgtacgtg
ctggacgcggcgatgcagccgcagccggtgggggtgccgggcgagctgtacatcggcggg
gtgcaagtggcgcgcggctaccagggacagccggcgcgcacggccgagcgcttcgtgccc
gatcccttcgcgagcacgccgggcgggcggctctaccgcacgggcgaccgggcgcggctg
cgcggcgacggcgcgatcgaatatctgggccggctcgatcaccaggtcaagctgcgcggc
gtgcgcatcgagctgggcgaggtggaggcggcgctgcaggcggtggccggggtggaccag
gcggtggccgtggtgcgcgaggacgtgctcggcgagcccagcctggtggcctacgtggtc
gccgcgactgcggccgaagccgaagccgcggccgagctgactcccggcgcgctgcgcgaa
gctctgcgcgcgcgtctgcccgaggccatggtgccgggcccgatcgtgttcgtgccggcg
ctgccgctcacggccagcggcaagctcgaccgcaaggcgctgccgcgtcccgaggcgccg
acgagcgccgagggcgacgccgacgccgccccgcgcacggcgaccgagcgcgcgctcgcc
gagctgtggcaggagctgctcggcgccgatcgcgtgggcgtaaacgacgacttcttccag
ctcggcggccactcgctgctggcggcccagctcatcgcccgcgtccgccgcgccttcgac
gtcgagctgccgctgcgcgcgatcttcgatgcgcccaccgtggccgcgttggccgcgcgg
ctggcctcggcgagcaaggccctggcgccagccgcgatcccgcagatcgcgcgcgacggc
gagctgccgctgtccttcggccaggagcgcctgtggtttctggaccagctcggcagcggc
accgcctacaacatgggcgcggccctgcgcctgcgcggccggctgaatgcggacgcgctc
gcgcgcgcgctgcaggaggtggtgcagcgtcacgaggtgctgcgcaccagcttcccggcc
gccgacgggcgaccgcgcccgagcatcgcggccacggctgagctgacgctcgcgcacctg
gacctgcgcggcgagagcggcgacatggaccagcgcctggcagcgctggccgaggcccac
gcggccgagcgcttcgatctggcccgcggtccgctgctgcgcgccagcctggtgcgcacg
ggcgaagacgagcacgtgctgctgttcgtgatgcatcacatcacctccgacggctggtcg
ctgcgcgtgctcggccgcgagctcggcgcgctgtacgcggcgttcgccgccggccaggcc
tcgccgctgccgcccttgcccatccagtacgccgactacgcggcctggcagcgcgcggcc
ctggccagcgacagcgcccgccagcagctcgcctactggcgacagaccctggccgaggtg
cccggcgcgctcgagctgccgaccacggagcgcgtccggccggcggtgcagagctaccgc
ggccgcgtcgtgcatgcgcgtgtgtccgaggagctgggccaggccctgcgcgagctcagc
cgcgagcgcggcgtgaccctgttcatgaccttgatggccggcttccaggtgttgctgtcg
cgctacgccgggcagcagcgcttcgccgtgggcacgcccgtggccaatcgcgcgcacggc
gatctcgagcagctcatcggcttcttcgtcaactcgctggccctgcccgcggacctcgtc
ccggcgtccccggaccaggccctcacctgcgccgcgctgctggcgcgcgtgcgcgacgcc
gcggtcggcgcctacgcgcatcaggaggtgccgttcgagaaggtcgtcgaggtgctcggg
gtcgagcgcgatccctcgcgcagcccggtgttccaggtgatgctctcgtacgagccggcg
gcgcggctggagctggcgctgcccggcatcgaggccgaggagctggcgttcccgaccggc
gacgccaagctcgatatgacgtggctgatgagcgacggcggcgcgggcgcgctgcagctc
atggtcgagtacaacgccgacctgttcgacgaagagcaggtggcgcgcatgtgcgggcac
ttcgaggcggtgctgcgggcgatggtggcagacgtggagcagccggcggcggcggtgtcg
ctgctggcggcggacgagcgcgcgcaggtggtggaggagtggaacgcgacggccgtggac
tacggggcggcgcaggcgctgcacgagctggtggaggcgcaggtggcgcgcacgcccgag
caggtggcggtggtgttcgaggggcgctcgctgagctaccgggagctggacgggtgggcg
aatcgcgtggcgcgggagctgcgggcgcggggcgtgggcgtggacgtgcgggtgggcgtg
tacatggagcgctcgctggagttgatggtggcgttgctggcgatcgcgaaggcgggcggg
gcgtacgtgccgctggagccgacgcatccggcggcgcgagtggcgcacctggtgcaggac
accggggcgctgctggtgctggcgcaggggccggtgcccggggaggtgtgcgcggcggac
aaggtgctggtggtggacgccgagctgggggccgggcaggcggagacggcgctgggtgtg
gcggtgccgccggaggcgctggcgtacgtgctctacacctcggggtcgacggggcagccc
aagggggtgatgaacagccacgcgggcatcagcaaccggctgcgctggatgcaggcggag
tacgagctgggcggcgaggacgtggtcttgcagaagacgccctttaccttcgacgtgtcg
gtgtgggagttcttctggccgctgatgacgggggcgcggctggtgctggcggcgcccggc
aagcacacggacgcggcgtacctgagcgccgtgatcggcgagcacggggtgagcacgatg
cacttcgtgccctcgatgctggcgctgtttttgcgcgacgcggagctggcggcgtgccag
gggctggagcgcgtgatctgcagcggtgaggcgctgagcgcggagctgtgccagcagacg
caggcggcgctgccgaacgcggggctgcacaacctctacggcccgaccgaggcggcggtg
gacgtgagtttctgggactgcgggtcgaattcggacggtcgtccggtgccgatcggtcgc
ccggtggcgaacaccacgctgtacgtgctggacgcggcgatgcagccgcagccggtgggg
gtgccgggcgaactgtacatcggcggggtgcaagtggcgcgcggctaccaggggcagccg
gcgcgcacggccgagcgcttcgtgcccgatcccttcgcgagcacgccgggcgggcggctc
taccgcacgggcgaccgggcgcggctgcgcggcgacggcgcgatcgaatatctgggccgg
ctcgatcaccaggtcaagctgcgcggcgtgcgcatcgagctgggcgaggtggaggcggcg
ctgcaggcggtggccggggtggaccaggcggtggccgtggtgcgcgaggacgtgctcggc
gagcccagcctggtggcctacgtggtcgccgaagccgcgaccgaagccgagaccgcggcc
gagctgtctcccggcgcgctgcgcgaagctctgcgcgcgcgtctgcccgaggccatggtg
ccgggcccgatcgtgttcctggcggcgctgccgctcacggccagcggcaagctcgaccgc
gaggcgctgccgcgtcccgaggcgccgaccagcgccgagagcgacgccgacgccgccccg
cgcacggcgagcgagcgcgcgctcgccgagctgtggcaggagctgctcggcgccgatcgc
gtgggtgtaaacgacgacttcttccagctcggcggccactcgctgctggcggcccagctc
gtcgcccgcgtccgccgcgccttcgagattgagctgcccatcgcggccctgttcacggcg
cccacggtggccgcgctcgcgcgccacatcgacgacatccgcgccgagcgcgccgcctcc
gggcacgccgagcgcgactggccgtccatgccgccgctcgcgccgcgggccgaggccggg
ccgattccgctgtcctacgagcaggagcggctgtggtttttgcagcagctctaccccagc
tcgccggcctacaacatgttcggcgcggtgcgcatgcacggcccgctggacggcgacgcc
tttgcgcgcgccctggacgaggtggtgtgccggcacgagtctctgcgcacgaccatcgac
gccccgctgggtccgccgcgccaggtcgtccacgagcaccagcccgcgccgctacagctc
atcgacctgagccaccacggcgacccgcagagcgcgctcgcccagcgcatccagcgcgag
gcccagcagcccttcgatctcgagcgcggcccgctgctgcgcgtgcgcctggtgcgcgag
cgcgcggacagccacgtcctgctggtctgtatgcaccacattatttcggacggctggtcg
atcggcgtcttcgtgcgcgagctggcggcgctctacgacgcctacgccgccgatcagacc
gcgaagctgcccgagctgcgcgtgcagtacgccgactacgcggtctggcagcgcgcgtgg
ctcacgggcgaggtgctcgcgcagcagatgcagttctggcgcgaccagctcgccggcatc
cccacggcgctggagctgcccaccgactacccgcgcccgagcgcgccctcgttccgcggc
gcgcgccatcgcttcaccatcgcgccggccctgagccaggccgtcgccgacttcagccag
cagcgcggcgtgacccggttcaccacgctgatggcggcctttgccaccctgctgcaccgc
tacgccggccagcgcgacatcgcggtcggcaccccggtggccaaccggcccgaggtcgag
accgagcagctcatcggcttcttcgccaactccctggtgctgcgcacgcgcttcgacgac
gaccccaccgtggccgagctgatcgcgcaggtgcatcggaccagcctggacgcgctcgcg
caccagcaggtgccctttgcccagctcgtggccgagctgcagccgaatcgcgacaccagc
ctgtcgccgctgtttcaggtcatgttcggcctgcagaacacgcccgcggcgccggccgcg
ctcaccgggctgcgctggcagccgatcgaggtcgacgagcagagcacctccttcgacctg
agcctcatgctcgaggagcacgacggcggcttccgcggcaccctcgactacagcagcgat
ctgttcgcgccggcgaccatggagcgcttcgccgctcacctgctgcgcctgctcggggac
atgctcgcgcgcccccacgcgcgcgtgtcccagctcgcgctgctggccgactgggagcgc
gagcggctcgcggagtggaacgacaaccgcgtcgagcaccgcatcaccggtctggttcac
gacctgttcgacgagcaggtgcaggcgaccccggacgccatcgcggtgacctacgagggc
gcgcggctcagctatgcggagctcgatcgccgggccaatcgcgtggcccaccggctgatc
gcgatgggcgttcggcccgagcatcgggtggcgatctgcctgccgacctcgctcgaggtc
atcgtcggctctctgggcatcgtcaagtccggcggcgtggtgctgccgctcgatcccgat
tacccgcaggagcgcctggagctgctgctcagcgagtccgacgcccgcgtggtcatcggc
gacgcccgcgtgcgcgcgctgctggccgccgccagcacgtccggactcgccgccttgccc
ttcgtcgacatcgccgatctcggccccgccgcggcccaggacgacgcgagctgggagcgc
gcgcccgcgacctcggtgcatcccgacaacgcggtgtatctgttctacacctcgggctcg
accggcaagcccaagggcgtgctggtcacccaccgcggcatcgccaacgagctggcggcc
gagcgcctcacctacggtttgcgcccggggcaaggcgtgctgatggcgacatcggtcagc
ttcgatatgtcgctgtcgcagatctacccgccgctcatccagggcgcgaccctggtcatc
gcccggcccatgtcgaccgaggacgccagctatctgctgcgtctgatccgcgacgagaac
gtggtgctggcctcgttcgtgccctcgctgctggccgtgctcatggacgatccggccttc
gacgagtgtcggaatctgggccatatccaggcctgcggcgaggccctgctgcccgagctg
gtgcagcgcttctacggccgcacgccggccacgctgtggaactgctacggccccaccgag
gtgtccatcggcatcaccatcggcgaggtgccgcgccagctcgaggccacgcagggcacc
gcggtgaccatcggcgggcccatccccaacatccaggcctacgtgctcgacgagcacctg
cagccgctgcccatcggggtaccgggcgagctgtacctgggcggcgtgggcctggcccgc
ggctacctcaacgcgcccgggcgcacggcgcagagctttgtgcccgaccccttcgcgtcc
gcgcccggtcagcgcatgtaccgcaccggcgacctggcgcgcttccgcgaggacggcaac
ctcgagtgtctcggacgcgtggacgatcaagtcaaggtgcgcggctatcgcatcgagctg
ggtgaggtcgagtcggtgctgggccagcacgcgagcgtgcgcgaggccgtggccgccgcc
ttcgatcgcggcgacggcaacaagatcctcgtggcctacgtggagccgcgcgagcagcag
gacatcgacatggccgcgctgcgccgctacctgggcggccggctgcccagctacatggtg
cccacgcgcatcgtacagatggacgaaatgccgcgcagcgccagcggcaagatcaaccgc
cgcgcgctacccgcgcccgagctgggtcactcggatcgcgcctacgtggccccgcgcagc
gcggtcgagatcaccctggcgcagctctgggcggccctgctcggcgccgagcgcgtgggc
ctcgaggacgacttcttcgagttcggcggccactcgctgctggccacccagctcgtgtcg
cgggtgcgcgccaccttcggcatcgagatcccgctgcgcgcgctgttcgagacccgcacc
ctggcggcctttgcgcgcgaggtcgagcgccacgccaacatcggcccgcgggtggcgccg
ccggtcaccccggtgtcgcgcgagggcgagctggtgctgtcctttggccaggagcgcctg
tgggtgctcgatcagctcgatcgctcgacggcctacaacatgccgggcgcgatccggctg
agcggtcggctcgagcaccgggctctcgagcgcgcgctcgacgagatggtccggcgccac
gagtcgctgcgcaccgtcttcgagggccgcgacggccgccccgtgcagcgcatcctgccg
cccttcaccctggccttgccggtgctcgacctgcgcggccacgccgaccgcgagcagcgc
gccctgggctacatccacgaggtcgtcgaggagcccttcgacctggcccgcgggccgctg
gtgcgcggcgccctcgtgcacgtggagccggacgagcacgtgctggtcttcgccatgcac
cacatcgtgtccgacggctggtcgctggccgtcttcgcccgcgagctcggcgcgctctac
gccgcctacgccgccggccagccctcgccgctggccgagcccgcgatccagtacgcggac
tacgcggcctggcagcgcgcctggctcgatcaggagcgcgtcgaggagcagctcgcgtac
tggaagcagcagctcgccggagccccggccgcgctcgagctgcccctcgaccggccgcgg
ccgccgcgccagagcttccgcggcgcctacctcacgcgcccgatcagcaacgcgctcagc
gaggccgtggcagagctggcgcggcgcgagggcgcgaccctgttcatgaccctgctcgcg
gcctttcagtcgctgctggcgcgctacgccggccaggacgacgtcgtcgtgggcacgccc
atcgccaatcgccgccagcaggagaccgaggagctgatcggcttcttcgtcaacaccctg
gcgctgcgcaccgatgtcgccggcgagcccagcttccgcgagctgctggcgcgcgtgcgc
gacgtgaccctgggcgcctacgccaaccaggacctgcccttcgagcgcctggtggacgag
ctcttgccgcagcgcgacctgagccgctcgcccatcttccaggtgctgttcgcggtgcag
aacacgccctgggagccgctggtgctgtccgatatcgcgctcagccacgtcgacgtcgag
cccaacaccgccaagttcgatatcgagctgtcggtggtcgagaccgagaccggattgctg
gccacctacaactactgcaccgacctcttcgacgagcgcaccatcgagcgcatgcacgga
cacctggtcaacttactgcgcgcggtggtcgccgatcccgagcagtccatcgccagcgtg
tccttgctcgacgccgccgagcagcagaccgtggtgctggactggaaccagacccgcgcg
ccgctgcccggccagtgcgtccaccacgccgtcctcgcgcgggccgcggcccagcccgag
gccatcgccctgcgccacggcgaccagcagctcagctacgcggagctgcgcgcgcgcgcg
ggccggctggcgcggcatctgcgctccctgggcgtgggcgtggacgagcccgtggccctg
tacgtgcaccgctccttcgacatgatcgtcggcctgctcggcatcctcgaggccggcgcc
tgctgcgtgccgctggatccggcctatccgcagcagcgcatcgagttcatcctcggcgat
agccgcgcgcgcgtggtcgtcacccaggagcccttggccgagctgctgcccgcgggcgcg
ccccagagcgtgcgtctggaccgggacgcggccgcgctggccggccccgacagtgacagt
gacggcgacgcgctcgaggtcgccgtgagcctcgagaacctggtgtatctcatctacacc
tcgggctcgaccggcaagcccaaaggcgtggccatgacccacgccgcgctggccaatctc
atggactggcaggcgcgggaatcgagcgcgggcgccgggcgcaccttgcagttcgcgccg
ctgagcttcgacgtgtccttccaggaggtgttctccaccctgggccagggcggcaccctg
gtgctggtggacgaggacacgcgccgcgacttccgggcgctgctgcagctcatcgacgag
cagagcgtcaaccgggtgttcatgcccttcgtggccctgcgcggcatcgccgaggtcgcg
cgcggccagcgcctaccgccggctctgcgcgaggtcatcaccgcgggcgagcagctccag
atcacgcccgcgctcgaggcgctgttcgccaccgacgaggccgcggacggcgagcgggcg
ccgcgcgtgctggtcaatcagtacggcccctccgagacccacgtggccaccagctacacc
ctgtcggggccgccggacaggtggccgcggctgccgcccatcggcgcgcccgtggccaac
gcccgcgcctacgtgctcgacagcgccatgcacccggtgcccgtgggcgtgagcggtgag
ctgtacctcggcggcacctgcgtggcccgcggctacctggagcggccggggctcacggcc
gagcgcttcgtgcccgatcccttcgccgacgccgacgcgcccggagcccggctctaccgc
accggcgatctcgcccgctatcgcgccgatggcgccatcgagtttctcggacgcgtggac
cgacaagccaagatccgcggctaccgcgtggagctcggcgaggtcgagaccgccctgggc
gcgcacccggccatcgccgacgccgccgtgctcgcgcgcgaggacgcctccggcgccaag
cgtctcatcgcctatctcgtcgcccgccccggcgaatccgtagacgtacgccagctcgcg
gacgccctgggcagcgccttgcccgagtacatggtgccgtcggcctttgtgctcatgcac
gcgctgccgctcacgccctcgggcaaggtcgcccacgcgctgctgccgccgcccgagatg
gcgcgcgacgaggacgacgaggagttcgtggccccgcgcgcgggcatggaggagcgcctg
gccgcggtctggcgcgagctgctcgagatggacggcatcggcgcgcgcgacaacttcttc
gagctcggcggccactccctgctggccacccagctcatggcccgggtgttgcgagacacc
ggcgtcgatctgccgccgcgcaccgtgttcgaggcccccaccatcgaggagctggccgcg
ctcgtcgacgccgcgctgcccgcggcgcaggcgagcgagaccgaagtcgaagccgaaacc
ggacaagtgtccggggaagtgtccgggcaggtgtccgggcaggtgtccgagatcgacccc
gagagcgcggccgcggccccggcggccggcggtcgcttcgtgacccagcgcgggcacacg
ggcgacgtgcccctggcttttgcgcaggagcgcctgtggttcctcgatcagctcgagccc
tcggccgcctacaacctggtgggcgcgttccgcatgagcggcagcctgtcgctgcccgcg
ctcgcccacgcgctgagcggcgtggtgcaccgccacgagatcctgcgcaccaccttcccg
gccgtggacggccaacccgtgcagcgcatcgcgtccgccctggtgttgccgctgccggtg
ttcgacctgagcgcggccgcggagccccgggccgaggtcgcgcggcagctggccgaggag
gccggcacgcgcttcgacctggcgcgcggacccgtgctccgggtgcgtctgctgcgcacc
ggcgagcgcgagcacgtgctcatcttcgccatgcatcacatcgtcgccgacggctggtcc
atgagcatcctggcccgcgaggtggccgcgctgtacgaggcccatctgcgcgatcgcgag
tccgcgctgccgccgctgcccatccagttcgccgactatgcgctgtgggagcgcgcgcac
ctgcagggccaggtcatcgacgagcacatcgcctactggcgccaggccctggccggcgcg
cccacggccctcgagctgcccaccgatcgcccgcgcccggccatgcagacatcggccggc
gcgcatctgtccttcgaggtgccggccgagctgagcgcgcgcctgcgcgccctgggcagc
gagcacggctgcacgctgttcatgaccgtcttggccgccttccaggtgctcctggcccgc
tgcgccggacaggacgacgtgctggtgggcgcgcccgtggccaaccgcaaccgggccgag
gccgagggcctcatcggctgcttcatcaacaccatggtcgtgcgcggccgcctgtccgaa
aacccgcgcttccgcgacttcctggcccaggtgcgcgagaccaccctgggcgctcaggcg
caccgcgccgcgccctttgccctggtcgtggacgccctcgatctgccgcgcgacctgagc
cgctcgccgctgttccaggtcatgttcgcgctgcacaacctgccgcccgatcgcctcgag
ctgcccgggctcacgctcgagcccgtgcaggacgagatgcccttcgcgcgcttcgacctg
gccctggacctgtgggagagccgggccggcctgcgcggctccatggagtacaacaccgcc
ctcttcgacgaggccaccatcgcgcgcctgtgcgcgcagctcagccacgtgctcgcggcc
gtggtcgccgcgcccgacacgcccgtcgccgacatcccgctgatgccgcgcgaggcctcg
ctgcgccagctcgcgcagtggaacgacagcgcgcgcgccgtggacttcgagctgtccatc
accgcgcgcatcgccgctcaggccgagcgccagccccaggccacggccctggcgtgcggc
gcgcaggagctgagctacggcgccctgatcgcgcgcgtgcgccagctcgcccacgccctg
cgcggcatgggcgtgggacccgagcgcctggtcggcgtgtacctggagcgctccatcgac
atggtggtcgcggtcctggccgtgctcgaggccggcggcgcctacctgcccctggatccc
gcctatccgggcgagcgcctcgcgtacatgatcgcggacagcggcctcgcgctgctgctg
acccagggctccctgcgcgccagcctgccgccgcagcgcggccgcgccgtgtgcctcgac
gacgacgacacccgcgcgctggtggctcagcagccgagcgcggcgctggcgccggcggcg
ggcgccgatcacctcgcctacgtcatctacacctccggctccacggggcagcccaagggc
gtcgaggtgctgcggcgcggcctgcgcaacctcatccccacgctgggccagcagctcggc
atgagcgcggatgacgtcctggtgtccgcgacctcgctgtccttcgacatcgccatgctc
gagctgttcatgtcgctggccgcgggcgcgcgcctggtgctggcgtcccggcaggtggcc
ggcgacggcgtggccctgcgcgcgctgctgcgcgacagcggcgccaccgtctttcaagcc
acgccggccacctggcggctgctgagcgaggccggcaggagcgcggcggatggccggctg
cgcgtggcggtgtcgggcggcgaggccatgagcgaggccctggcccgcgagctggccgcg
agcgccgacgcggtgtggaacgtctacggccccaccgagaccaccatctggtccaccggc
tgccgcgtggacggcgccgcggcgatcaccatcggccagcccctggccaacacccgggcc
tacgtcctcgaccagcgccgcgagcccgtgcccgtgggcgtgctcggcgagctgtacctg
ggcggcgagggcgtggctcgcggctacctgggccggcccgcgctcacggccgagcgcttc
gtgcccgatcccttcgcccgcgccccgggcgcgcgcctgtaccgcaccggcgatcgcgtg
cgctggcaggccgacggcagcctggtgttcctgggccgcgtcgaccaccaggtcaaagtg
cgcggccaccgcatcgagctgggcgagatcgagacctgcctggcccggcatcccgcggtc
cagcacgccgtggtcgtggtgcgccaggtccagggcgagccccagctcgtggcctacttc
acccgccgcgagcgcgccgaggccgacgccgacgcgctcgcgccggccgaggcgcgcgac
ttcctgcgcgccaccttgcccgagtacatggtcccgagcacctacgtggcgctggacgag
ctgccgctcaccggcagccgcaaggtcgatcgccgggccctgcccgagcccgagcagcac
ggcgtggcccgcgcccacgtggcgccgcgtcccggcctcgagagcgagctggccgcgctg
tggtgcgaggttctgggctgcgagcagctcggcgccgacgatgacttcttcgagcgcggc
ggccactcgctgctggccgtgcgcctgctcgcggccatgaagcagcgcgttggcatcgag
ctgcccgtggccaccctgtttcaggccagcaccgtggcccggctggccgccgccgtcgag
cgcgcgcgcaccggcagcgcgcccggggccgtgctggtgcccctggccagccgcggcgcc
ggcgcgccgttcttctgcgtgcacctcatcggcggcgacgtggtgtgctacgccggcctg
gcccgggccctcgacgggcggcccttccgcgccctgcgcgcccccggcctggatcccgag
agcgagcccgtggccagcatcgaggccctggccgcgcgctacatcgcggagctgcggacc
gtgcaagcccaggggccctacctcctgggcggctggtccttcggcggcctggtcgcgctc
gagatggcgcggcagctcgcggcccaggggcacgccgtggcccgggtggcgctgctcgac
acccacccgccgagcggcgacgcgcccgtggacgcggacgccgcgcggcgcatgttcgtg
gccgatctgatcggcctgtacggcgatcccgcccgggtcgcgcccgatgacgagcacctg
gccgggctcgacgacatggccgcggccgtgcgccacctgcaagccctgggcgcgctgccc
gcggagctggagatcgccgacctgagccgccgcttgcgcgtgttccaggcccacctggcc
gccgagcacggctatcggccggtcgcctacgacggccccgtgaccctgctgcgcgcggcc
caggccctgcccgagagccacgcgggcgaggccggcgacctggccgagcgctggcgcgcc
gcgggcgtgcgcgcgctcgccgagcgcactgttccgggcgatcacttcaccatgctggcg
cccgcgcacgcggtcgagctcggccgcatcctgagcgcctgcctggccgacgcggacgcg
cacgccagcgccgtcggcgcaggtgccggcgaaggcgccggcgaaggtgccggcgaaggc
gccggcgaaggtgccggcgaaggcgagggcggcgcgtccgcaggcacctcgtcgcggagg
aaaacgatatga

DBGET integrated database retrieval system