KEGG   Haemophilus parasuis ZJ0906: K756_02895Help
Entry
K756_02895        CDS       T02697                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hpaz  Haemophilus parasuis ZJ0906
Brite
Enzymes [BR:hpaz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     K756_02895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(545485..546027)
Genome map
AA seq 180 aa AA seqDB search
MKKTVLTLALTALFGFSTSAIANSATQIEVKVQQLDLQNGNKDVGTVTITESPYGLVFTP
NLKGLSHGLHGFHIHEKPSCEPKEKDGKLVAGLGAGGHWDPKETKKHGYPWSDEAHLGDL
PALAVDHEGNATNPVLAPRLKKLEEVKGRSLMIHAGGDNHSDHPAPLGGGGARMACGVIN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagttttaacccttgctttaacagcacttttcggattttcaacttcagcg
atagcaaattcagctacccaaattgaagtgaaagttcaacaacttgatttacaaaatggc
aacaaagatgtgggaacggtgacgattaccgaatcgccttacggtttagtttttacccca
aatctgaaaggattgtcacacggcttacacggtttccatattcacgagaaaccaagctgt
gaaccaaaagagaaagatggcaaattagtcgctggcttaggtgcaggcggtcactgggat
cctaaagagacgaaaaagcacggttatccttggtctgatgaagcgcatttaggtgattta
cctgcattagcggttgatcacgagggtaatgcgactaatccagttcttgcaccacgtttg
aaaaagttagaagaagtgaaaggtcgttcattgatgatccacgcaggtggcgataaccat
tcagaccacccagcaccacttggcggtggcggagcaagaatggcttgcggtgttattaac
taa

DBGET integrated database retrieval system