KEGG   Helicobacter pylori 51: KHP_1011Help
Entry
KHP_1011          CDS       T02082                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpd  Helicobacter pylori 51
Pathway
hpd00010  Glycolysis / Gluconeogenesis
hpd00020  Citrate cycle (TCA cycle)
hpd00620  Pyruvate metabolism
hpd00640  Propanoate metabolism
hpd00650  Butanoate metabolism
hpd00680  Methane metabolism
hpd01100  Metabolic pathways
hpd01120  Microbial metabolism in diverse environments
hpd01130  Biosynthesis of antibiotics
hpd01200  Carbon metabolism
Module
hpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KHP_1011 (porA)
   00020 Citrate cycle (TCA cycle)
    KHP_1011 (porA)
   00620 Pyruvate metabolism
    KHP_1011 (porA)
   00640 Propanoate metabolism
    KHP_1011 (porA)
   00650 Butanoate metabolism
    KHP_1011 (porA)
  Energy metabolism
   00680 Methane metabolism
    KHP_1011 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KHP_1011 (porA)
Enzymes [BR:hpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     KHP_1011 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACX98208
UniProt: D0ITG5
LinkDB All DBs
Position
1119291..1120514
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKDIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaactacaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcattgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtagaatctgagcatgccgccatgagtgcatgcgtgggagctgcagcagctggggga
agggtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcccatcgttttgaatttagtcaatcgcgctttagcagcccct
ttaaatatccatggcgatcattctgatatgtatttgagtagggattctggctggataagt
ttatgcacatgcaaccctcaagaggcttatgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaagtgcgtgtgcctactattgtcaatcaagatggatttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaagacattaaggccggcgtggcgacc
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagacaaaagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacgagtgcggtgtatcaaacacaagggactaaacaccctgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system