KEGG   Helicobacter pylori ELS37: HPELS_01120Help
Entry
HPELS_01120       CDS       T01798                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00010  Glycolysis / Gluconeogenesis
hpe00020  Citrate cycle (TCA cycle)
hpe00620  Pyruvate metabolism
hpe00640  Propanoate metabolism
hpe00650  Butanoate metabolism
hpe00680  Methane metabolism
hpe01100  Metabolic pathways
hpe01120  Microbial metabolism in diverse environments
hpe01130  Biosynthesis of antibiotics
hpe01200  Carbon metabolism
Module
hpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_01120 (porA)
   00020 Citrate cycle (TCA cycle)
    HPELS_01120 (porA)
   00620 Pyruvate metabolism
    HPELS_01120 (porA)
   00640 Propanoate metabolism
    HPELS_01120 (porA)
   00650 Butanoate metabolism
    HPELS_01120 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPELS_01120 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPELS_01120 (porA)
Enzymes [BR:hpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPELS_01120 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFF19801
UniProt: H8H7K7
LinkDB All DBs
Position
complement(222408..223631)
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGTFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcccatcaccccatcaacc
cccattgtgcaaaattatggcacctttaaggataatggctatattgatggcgagtttgtt
ttagtggaatctgagcatgccgctatgagcgcatgcgtgggagctgctgcagcaggtgga
agggtcagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttaaatatccatggcgatcattcggatatgtatttaagcagggattcaggctggatcagt
ttatgcacatgcaaccctcaagaagcttacgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagatgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccctttcccttatgaaagattggggcaggatttgaaaaatcttaag
gctctagcgattttagacaaaagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccctgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggtttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system