KEGG   Halanaerobium praevalens: Hprae_0011Help
Entry
Hprae_0011        CDS       T01941                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hpk  Halanaerobium praevalens
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hprae_0011
Enzymes [BR:hpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hprae_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
18569..20044
Genome map
AA seq 491 aa AA seqDB search
MSKNNYDVIIVGGGISGCAVAWKLARYNLDVLLLEKEPDVATGTTKANTAIIHAGYNADP
EKQKGRLNNKGNVQIKEIVKDLNVPFEEIGSLVVGMEGDDLSVLDDLLEKGKKNGVEGLK
IVDKEWLQKEEPNLSDKAVKALWAPTAGIITPWEFALAMAENAVANGVEVKLETEVLDVY
TEADQVRGVKTNQGDFKADYVINAAGLYADEIAKMVGVEKIDIHPRKGEYFIYDHAKDFE
INHVLFPIPTKISKGIVCTKTVEDNLLIGPTSDFVDSKEDLATTREGLDHVFNGAKKMFP
DLTLKDSIRVFAGLRAADTTEDFVIEAAENVAGFVNVAGIQSPGLSSAPAIADLVAEILE
DQGLKLEAKAEVIETREDPARFYEISNEERAAYAEKDKDYGKIICRCETVSYKEIVDAIN
GPIPARTINAVKRRTRAGAGRCQGGFCGPRVTEIIAEELGIETTEVRLEKDNSNIVEHKI
KGLLGSQGDVE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaaaaataattatgatgtaattattgttggaggaggtatttctggttgtgcagtt
gcctggaaacttgctcgttataatttagatgtactattattagaaaaagaacctgatgtt
gcgactggtacaacaaaggctaatacagcaattattcatgctggttataatgctgatccc
gaaaagcaaaagggaagattaaataataaaggtaatgtgcaaattaaagagatagtaaaa
gatttaaatgtaccctttgaagaaatcggctctttagtggttggaatggagggtgatgat
ttaagtgttttagatgatctattagaaaaaggtaagaaaaatggggtagaaggtttaaaa
atagttgataaagaatggctgcaaaaagaagaaccaaatttaagtgataaagcagtaaag
gctttatgggcacctactgctgggataataaccccttgggaatttgctttagctatggcc
gaaaatgctgtagcaaatggagtggaagtaaaattagaaactgaagttttagatgtttat
acagaagcagatcaggtaagaggagttaaaactaatcaaggagattttaaagctgattat
gttattaacgctgctggtctttatgctgatgaaatagctaaaatggttggagtagaaaaa
attgatattcatcctagaaaaggtgaatactttatttatgaccatgcaaaggattttgaa
ataaaccatgttttattcccaattccaacaaaaatttctaaaggaattgtttgcactaaa
actgttgaagataatcttttgattgggccaacttctgattttgttgatagtaaagaagat
cttgctacaactagagaaggtttagatcatgtttttaatggtgctaaaaaaatgtttcca
gatttaactttaaaagatagtattagagtttttgcgggtttaagagctgctgatacaact
gaagattttgtaattgaagctgcagaaaatgttgctggttttgttaatgttgctggaatt
caatctcctggtttatcttcagctccagctattgcagatctggtagctgaaatattagaa
gatcaaggcttaaagctagaagctaaagctgaagtaatagaaaccagagaagatcctgct
agattttatgaaatttcaaatgaagaaagagcagcctatgctgaaaaagataaagattat
ggtaaaatcatttgccgctgtgaaactgtatcttataaagaaattgtagatgcgattaat
ggtccaattccagctagaactataaatgctgttaaaagaagaactagagctggagctgga
agatgtcagggaggattctgtggacctagagttacagaaataattgctgaagaacttgga
attgagacaactgaggttagactagaaaaagataattcaaatattgttgaacataaaatc
aaaggattactcgggagtcagggtgatgtagaatga

DBGET integrated database retrieval system