KEGG   Helicobacter pylori Shi470: HPSH_05705Help
Entry
HPSH_05705        CDS       T00742                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00010  Glycolysis / Gluconeogenesis
hps00020  Citrate cycle (TCA cycle)
hps00620  Pyruvate metabolism
hps00640  Propanoate metabolism
hps00650  Butanoate metabolism
hps00680  Methane metabolism
hps01100  Metabolic pathways
hps01120  Microbial metabolism in diverse environments
hps01130  Biosynthesis of antibiotics
hps01200  Carbon metabolism
Module
hps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSH_05705 (porA)
   00020 Citrate cycle (TCA cycle)
    HPSH_05705 (porA)
   00620 Pyruvate metabolism
    HPSH_05705 (porA)
   00640 Propanoate metabolism
    HPSH_05705 (porA)
   00650 Butanoate metabolism
    HPSH_05705 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPSH_05705 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSH_05705 (porA)
Enzymes [BR:hps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSH_05705 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACD48547
LinkDB All DBs
Position
1125414..1126637
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDTVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCGIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattacaagagatagaggtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgagcatgccgccatgagtgcatgcgtgggagctgcagcagctggtgga
agggttagcactgcgactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcccactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatacagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggcgacc
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagataagagctctccagcgggcgctatgggagcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcggaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggtcctaaaatgagctttttttaa

DBGET integrated database retrieval system