KEGG   Helicobacter pylori UM299: K749_00875Help
Entry
K749_00875        CDS       T02661                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpym  Helicobacter pylori UM299
Pathway
hpym00473  D-Alanine metabolism
hpym01100  Metabolic pathways
hpym01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpym00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    K749_00875
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    K749_00875
Enzymes [BR:hpym01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     K749_00875
Peptidoglycan biosynthesis and degradation proteins [BR:hpym01011]
 Precursor biosynthesis
  Racemase
   K749_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGL67567
LinkDB All DBs
Position
1186343..1187476
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNTASLRHNFSAVKSIVPKDAHIMAVVKANAYGVGAIKASEIFLQEGANYL
GVATLDEALELRSHFSKTPILILGYSPNANASMLIDNDLSAMIFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPNFKSIEIIKKIRALKGLEVEGIFTHLSNADAKIKTHAKNQ
MEAFNAFLEQLLNQKIEFQYRHAYNSAGILSLCNGNENRLLNLYRPGIMLYGFYPSNGMK
ETCPIILKNVISLKAQIVQIRSVKKGEFIGYGEHFYTNEETLVGVLALGYADGLMRALGN
RIQVTINNQLAPLIGKVCMDQCFVKLNNIEAKEGDEVILFGDKSAKANDASEIAALLNTI
PYETISTLSKRLERVYI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataccgcttctttaaggcataattttagc
gcagtcaaaagcattgtccctaaagacgcccacatcatggcggttgtcaaggcgaacgct
tatggggtaggagccataaaagcgagcgaaattttcttacaagaaggggctaattattta
ggggtagcgaccttagatgaagctttagagttgcgctctcatttttctaaaacccccatt
ttgattttaggctatagtcctaatgctaacgcttccatgctgattgataacgatttgagc
gctatgatttttagccttgaacaagcggaagttttttctcaaatggctttaaaatctcaa
aaacgcttaaaaattcatctcaaaattgataccggcatgcaccgcttgggattagagcct
aattttaaaagcatagaaatcattaaaaaaatccgtgctttaaaaggcttggaagtggaa
gggatattcacgcatttaagcaacgctgatgctaagattaaaacccatgctaaaaaccaa
atggaagcctttaacgcttttttagagcagcttttaaatcaaaaaatagagtttcaatac
cgccatgcttacaattccgccggtatcctttctttgtgtaatgggaatgaaaatcgcttg
ttaaacctctatcgcccaggaatcatgctctatggtttttacccttctaatggaatgaaa
gaaacatgcccaataatcttgaaaaatgttatcagtttgaaagctcaaatcgttcaaatc
agaagcgttaaaaaaggcgaatttattggctatggcgagcatttttacacgaatgaagaa
actttagtgggtgttttagctctagggtatgcggatgggttaatgcgcgctttaggcaat
cgcattcaggttacgatcaataaccagttagccccccttattggtaaggtgtgcatggat
cagtgctttgttaagctcaataatattgaagccaaagagggcgatgaggtcatcttattt
ggggataaaagcgctaaggctaatgacgcaagcgaaatcgctgcacttttaaacaccatt
ccttatgaaaccatcagcaccctatccaaacgcttggagcgcgtctatatttaa

DBGET integrated database retrieval system