KEGG   Helicobacter pylori SouthAfrica20: HPSA20_0995Help
Entry
HPSA20_0995       CDS       T02807                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hpys  Helicobacter pylori SouthAfrica20
Pathway
hpys00473  D-Alanine metabolism
hpys01100  Metabolic pathways
hpys01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpys00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPSA20_0995 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPSA20_0995 (alr)
Enzymes [BR:hpys01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPSA20_0995 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:hpys01011]
 Precursor biosynthesis
  Racemase
   HPSA20_0995 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGT74228
UniProt: T1UCR9
LinkDB All DBs
Position
complement(935632..936765)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVDTSSLRHNFNAVKNAIPKDAHIMAVVKANAYGVGAIKASEVFLQEGAHYL
GVATLDEALELRFHFPKTPILILGYSPNSNAQMLVDNHLGAMIFSLEQAEVFSQIALKSK
KRLKVHLKIDTGMHRLGLEPNFKSVEIIKKIRALKGLEVEGIFTHLSNADANIKTHAKNQ
MKAFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNNNENRFLNLYRPGIMLYGFYPSNEMK
ESCPTILKNVVSLKAQIVQIKRVKKGEFVGYGKHFYTNEETLVGVLALGYADGLARALGN
RIQVVINDQLAPLIAKVCMDQCFIKLNGIEAKEGDEVILFGDKSTKANDANEIATLLNTI
PYEVISTLSKRLERVYV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtggaggtggacacttcttctttaaggcataattttaat
gcagtcaaaaacgctatccctaaagacgcccatatcatggcggttgtcaaggcgaacgct
tatggggtgggggcgattaaagcgagtgaggtttttttgcaagagggggcgcattattta
ggggtagcgaccttagatgaagctttagaattgcgttttcattttcctaaaacccctatt
ttgattttaggttatagccctaattctaacgctcaaatgttggttgacaatcatttgggt
gccatgatttttagccttgaacaagccgaggttttttctcaaatagctttaaaatccaaa
aaacgcttgaaagtgcatctcaaaattgataccgggatgcaccgcttgggtttagagcct
aattttaaaagcgtagaaatcattaaaaaaatccgcgctttaaagggtttggaagtggag
gggattttcacgcatttgagcaacgctgatgctaacattaaaacccatgctaaaaaccaa
atgaaagcctttaacgcttttttagaacagcttttggatcaaaaaatagagttccaatac
cgccatgcttataattccgccggcatcctttctttgtgcaacaacaatgaaaatcgcttc
ttaaacctttatcgcccagggatcatgctctatggcttctacccctctaatgaaatgaaa
gaatcgtgtcccacgatcttaaaaaatgttgtgagcctgaaagctcaaatcgttcaaatc
aaacgagtcaaaaaaggcgagtttgttggctatggcaagcatttttacacgaatgaagaa
actttagtgggtgttttagcgctagggtatgcggacgggttagcgcgcgctttgggcaat
cgcattcaagtcgtaatcaatgaccaactagcccccttgatcgctaaagtgtgcatggat
caatgctttattaagcttaatggcattgaagctaaagaaggcgatgaagtcattttgttt
ggggataaaagcaccaaggctaacgatgcaaacgaaatcgccacgcttttaaacaccatt
ccttatgaagtcatcagcaccctatccaaacgcttggagcgcgtttatgtgtga

DBGET integrated database retrieval system