KEGG   Homo sapiens (human): 10026Help
Entry
10026             CDS       T01001                                 

Gene name
PIGK, GPI8
Definition
phosphatidylinositol glycan anchor biosynthesis, class K (EC:3.-.-.-)
Orthology
K05290  
phosphatidylinositol glycan, class K [EC:2.6.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1p31.1
AA seq 395 aa AA seqDB search
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYR
HVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVD
YRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPA
IGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLI
TDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPK
LKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaccgacagcctcagccgggctgcgactgtcttggcaactgtgttgctcttg
tccttcggcagcgtggccgctagtcatatcgaggatcaagcagaacaattctttagaagt
ggccatacaaacaactgggctgttctggtgtgtacatcccgattctggtttaattatcga
catgttgcaaataccctttctgtttatagaagtgtcaagaggctaggtattcctgacagt
cacattgtcctaatgcttgcagatgatatggcctgtaatcctagaaatcccaaaccagct
acagtgtttagtcacaagaatatggaactaaatgtgtatggagatgatgtggaagtggat
tatagaagttatgaggtaactgtggagaattttttacgggtattaactgggaggatccca
cctagtactcctcggtcaaaacgtcttctttctgatgacagaagcaatattctaatttat
atgacagggcatggtggaaatggtttcttaaaatttcaagattctgaagaaattaccaac
atagaactcgcggatgcttttgaacaaatgtggcagaaaagacgctacaatgagctactg
tttattattgatacttgccaaggagcatccatgtatgaacgattttattctcctaacata
atggctctagctagtagtcaagtgggagaagattcactctcgcatcaacctgatcctgca
attggagtccatcttatggatagatacacattttatgtcttggaatttttggaagaaatt
aacccagctagccaaactaatatgaatgacctttttcaggtatgtcccaaaagtctgtgt
gtgtctactcctggacatcgcactgatctttttcagagggatcctaaaaatgtactgata
actgatttctttggaagtgtacggaaagtggaaattacaacagagactattaaattgcaa
caggattcagaaatcatggaaagcagctataaggaagaccagatggatgagaaactaatg
gaacctctgaaatatgctgaacaacttcctgtagctcagataatacaccagaaaccgaag
ctgaaagactggcatcctcctgggggctttattctgggattatgggcacttattatcatg
gttttcttcaaaacttatggaattaagcatatgaagttcattttttag

DBGET integrated database retrieval system