KEGG   Homo sapiens (human): 10060Help
Entry
10060             CDS       T01001                                 

Gene name
ABCC9, ABC37, ATFB12, CANTU, CMD1O, SUR2
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Orthology
K05033  
ATP-binding cassette subfamily C (CFTR/MRP) member 9
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Disease
H00294  
Dilated cardiomyopathy (DCM)
H00731  
Atrial fibrillation
Drug target
Nicorandil: 
Pinacidil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10060 (ABCC9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10060 (ABCC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12p12.1
AA seq 1549 aa AA seqDB search
MSLSFCGNNISSYNINDGVLQNSCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHH
NTWLHFPGHNLRWILTFALLFVHVCEIAEGIVSDSRRESRHLHLFMPAVMGFVATTTSIV
YYHNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNLRFCITGMMVILNGLL
MAVEINVIRVRRYVFFMNPQKVKPPEDLQDLGVRFLQPFVNLLSKATYWWMNTLIISAHK
KPIDLKAIGKLPIAMRAVTNYVCLKDAYEEQKKKVADHPNRTPSIWLAMYRAFGRPILLS
STFRYLADLLGFAGPLCISGIVQRVNETQNGTNNTTGISETLSSKEFLENAYVLAVLLFL
ALILQRTFLQASYYVTIETGINLRGALLAMIYNKILRLSTSNLSMGEMTLGQINNLVAIE
TNQLMWFLFLCPNLWAMPVQIIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEA
QKSTLDYSTERLKKTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLSI
FMNAAIPIAAVLATFVTHAYASGNNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTR
RLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILG
EMQTLEGKVHWSNVNESEPSFEATRSRNRYSVAYAAQKPWLLNATVEENITFGSPFNKQR
YKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFS
ALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLTHADWIIAMKDGSVLREGTLKDIQ
TKDVELYEHWKTLMNRQDQELEKDMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEE
EDEDDNMSTVMRLRTKMPWKTCWRYLTSGGFFLLILMIFSKLLKHSVIVAIDYWLATWTS
EYSINNTGKADQTYYVAGFSILCGAGIFLCLVTSLTVEWMGLTAAKNLHHNLLNKIILGP
IRFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLSAIGMISYATPVFLVALL
PLGVAFYFIQKYFRVASKDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETRFKQRMLE
LTDTNNIAYLFLSAANRWLEVRTDYLGACIVLTASIASISGSSNSGLVGLGLLYALTITN
YLNWVVRNLADLEVQMGAVKKVNSFLTMESENYEGTMDPSQVPEHWPQEGEIKIHDLCVR
YENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKL
PLHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDA
VVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQKVVMTAFADRTV
VTIAHRVSSIMDAGLVLVFSEGILVECDTVPNLLAHKNGLFSTLVMTNK
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttcattttgtggtaacaacatttcttcatataatatcaacgatggtgtacta
caaaattcctgctttgtggatgccctcaacctggtccctcatgtctttctgttgtttatc
acttttccaatattgtttattgggtgggggagccaaagctcaaaagtacaaattcaccac
aacacatggcttcattttccgggacataacctgagatggattcttacattcgctctcctg
tttgtgcatgtctgtgaaatagcagaaggcattgtttcagactcgcggcgggaatcaagg
cacctccacctctttatgccagccgtgatgggattcgttgccactacaacatcgatagtg
tattatcataatatcgaaacatcaaattttcctaaattacttttagccctgttcctgtat
tgggtaatggcctttattacaaaaacaataaaattggttaagtactgtcagtctggcttg
gacatatcaaacctgcgtttctgcatcacaggcatgatggtcatcttgaatgggctcttg
atggctgtggagatcaatgtcattcgagtcaggagatatgtatttttcatgaatcctcag
aaagtaaagcctcctgaagacctccaggatctgggagtgagatttcttcaaccatttgtg
aatttgctgtcaaaagcaacatactggtggatgaacacacttattatatctgctcacaaa
aagcctattgatctgaaggcaattggaaaattgccaatagcaatgagagcagtaacaaat
tatgtttgcctgaaagatgcatatgaagaacaaaagaaaaaagttgcagatcatccaaat
cggactccatctatatggcttgcaatgtacagagcttttgggcgaccaattctacttagt
agcacattccgctatctggctgatttactgggttttgctggacctctttgtatttctgga
atagttcagcgtgtgaatgaaacccagaatgggacaaataacacaactggaatttcagaa
accctctcatcaaaggaatttcttgaaaacgcttacgttctagcagttcttctcttcttg
gctcttattctgcaaaggacatttttgcaggcttcctactatgtaaccatagagactggc
attaacctccgtggagctctgctggccatgatttataataaaatccttaggctctctacg
tctaacttatccatgggggagatgactctggggcagatcaacaacttagtcgccattgaa
actaatcaactcatgtggtttttgttcctgtgtcccaatctatgggctatgcctgttcag
atcataatgggcgtgattctgctctataatttacttggatcaagtgcattggtcggtgca
gctgtcattgtgctccttgcgccaattcagtactttattgctacaaagttggcagaggct
cagaaaagtacacttgattattccactgagagactcaagaaaacaaatgaaatattgaaa
ggcatcaaacttctaaaattgtatgcctgggaacacattttctgcaaaagtgtggaggaa
acaagaatgaaagaactatctagtctcaaaacctttgcactatatacatcactctccatc
ttcatgaatgcagcaattcccatagcagctgttcttgctacatttgtgacccatgcgtat
gccagtggaaacaatctgaaacctgcagaggcctttgcttcactgtctctcttccatatc
ctggtcacaccactgttcctgctctccacggtggtcagatttgcagtcaaagccatcata
agtgttcaaaagctgaatgagtttctcttgagtgatgagattggtgacgacagttggcga
actggtgaaagttcgcttccttttgagtcctgtaagaagcacactggagttcagccaaaa
actataaacaggaaacagcctggaagatatcacctggacagctatgagcaatcaacacgg
cgtctacgtcccgcagaaacagaggacattgcaataaaggtcacaaatggatacttttca
tggggcagtggtttagctacattatccaatatagatattcgaattccaacaggtcagtta
accatgattgtgggccaagtaggatgtgggaagtcctctcttctccttgccatcctcggt
gagatgcagacattggaaggaaaagttcactggagcaatgtaaatgaatctgagccttct
tttgaagcaaccagaagtaggaacaggtactctgtggcatatgcagctcaaaagccttgg
ctattaaatgctacagtagaagaaaatattacttttggaagtccttttaacaaacagagg
tacaaagctgtcacagatgcctgttctcttcagccagatattgacttattaccatttgga
gatcaaactgaaattggagagaggggcatcaacctgagtgggggacagaggcagagaatc
tgtgtggcacgagcgctgtatcaaaacaccaacattgtctttttggatgatccattctca
gccctggacattcacttgagtgatcatttaatgcaggaggggattttgaaattcctgcaa
gatgacaaaaggacactcgttcttgtgactcacaaattacagtatctgacgcatgctgac
tggatcatagccatgaaagatggaagtgtcctaagagaaggaactttgaaggacattcaa
accaaagatgttgagctttatgaacactggaaaacacttatgaatcggcaagatcaagaa
ttagaaaaggatatggaagctgaccaaactactttagagaggaaaactctccgacgggcc
atgtattcaagagaagccaaagcccagatggaggacgaagacgaagaggaagaagaggag
gaagatgaggatgataacatgtccactgtaatgaggctcaggactaaaatgccatggaaa
acctgctggcgctacctgacatctggaggattcttcctgctcatcctgatgattttctct
aagcttttgaagcattcggtcattgtagctatagactattggctggccacatggacatcg
gagtacagtataaacaatactggaaaagctgatcagacctactatgtggctggctttagc
atactctgtggagcaggcattttcctttgccttgttacatccctcactgtagaatggatg
ggtctcacagctgccaaaaatcttcaccacaaccttctcaataagataatccttggacca
ataaggttttttgataccacacccctgggactgattctcaatcgcttttcagctgatact
aatatcattgatcagcacatccctccaaccttggaatctctaactcgctcaacactgctc
tgcctgtctgccattgggatgatttcttatgctactcctgtgttcctggttgctctcctg
ccccttggtgttgccttttattttatccagaaatactttcgggttgcctctaaggacctc
caggaacttgacgatagtacccagctccctctgctctgtcacttctcagaaacagcagaa
ggactcaccaccattcgggcctttaggcatgaaaccagatttaaacaacgtatgctggaa
ctgacggatacaaacaacattgcctacttatttctctcagctgccaacagatggctggag
gtcaggacggattatctgggagcttgcattgtcctcactgcatctatagcatccattagt
gggtcttcgaattctggattggtaggcttgggtcttctgtatgcacttacgataaccaat
tatttgaattgggttgtgaggaacttggctgacctggaggtccagatgggtgcagtgaag
aaggtgaacagtttcctgactatggagtcagagaactatgaaggcacaatggatccttct
caagttccagaacattggccacaagaaggggagatcaagatacatgatctgtgtgtcaga
tatgaaaataatctgaaacctgttcttaagcacgtcaaggcttacatcaaacctggacaa
aaggtgggcatatgtggtcgcactggcagtgggaaatcatcgttatctctggctttcttc
agaatggttgatatatttgatggaaaaattgtcattgatgggatagacatttccaaatta
ccactgcacacactacgttctagactttcaatcattctgcaggatccaatactattcagt
ggttccattagatttaatttagatccagagtgcaaatgcacagatgacagactctgggaa
gccttagaaattgctcagctgaagaatatggtcaaatctctacctggaggtctagatgcg
gttgtcactgaaggtggggagaattttagcgttggacagagacagctattttgccttgcc
agggcctttgtccgcaaaagcagcattcttattatggatgaggcaacagcttccattgac
atggccacagagaatattttgcaaaaagtagtaatgacagcctttgcagaccggaccgtg
gtgacaatagctcaccgtgtctcttctattatggatgcaggccttgttttagtcttttct
gagggtattttagtggagtgtgatactgtcccaaatttgctcgcccacaagaatggcctc
ttttccactttggtgatgaccaacaagtag

DBGET integrated database retrieval system