KEGG   Homo sapiens (human): 10113Help
Entry
10113             CDS       T01001                                 

Gene name
PREB, SEC12
Definition
prolactin regulatory element binding
Orthology
K14003  
prolactin regulatory element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10113 (PREB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2p23.3
AA seq 417 aa AA seqDB search
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSAS
LLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKG
AAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRV
WKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPTF
SSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH
EVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRGPE
LLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQSAFPGFL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcgccgggcgccagagctgtaccgggctccgttcccgttgtacgcgcttcag
gtcgaccccagcactgggctgctcatcgctgcgggcggaggaggcgccgccaagacaggc
ataaagaatggcgtgcactttctgcagctagagctgattaatgggcgcttgagtgcctcc
ttgctgcactcccatgacacagagacacgggccaccatgaacttggcactggctggtgac
atccttgctgcagggcaggatgcccactgtcagctcctgcgcttccaggcacatcaacag
cagggcaacaaggcagagaaggccggttccaaggagcaggggcctcgacaaaggaaggga
gcagccccagcagagaagaaatgtggagcggaaacccagcacgaggggctagaactcagg
gtagagaatttgcaggcggtgcagacagactttagctccgatccactgcagaaagttgtg
tgcttcaaccacgataataccctgcttgccactggaggaacagatggctacgtccgtgtc
tggaaggtgcccagcctggagaaggttctggagttcaaagcccacgaaggggagattgaa
gacctggctttagggcctgatggcaagttggtaaccgtgggccgggaccttaaggcctct
gtgtggcagaaggatcagctggtgacacagctgcactggcaagaaaatggacccaccttt
tccagcacaccttaccgctaccaggcctgcaggtttgggcaggttccagaccagcctgct
ggcctgcgactcttcacagtgcaaattccccacaagcgcctgcgccagccccctccctgc
tacctcacagcctgggatggctccaacttcttgccccttcggaccaagtcctgtggccat
gaagtcgtctcctgcctcgatgtcagtgaatccggcaccttcctaggcctgggcacagtc
actggctctgttgccatctacatagctttctctctccagtgcctctactacgtgagggag
gcccatggcattgtggtgacggatgtggcctttctacctgagaagggtcgtggtccagag
ctccttgggtcccatgaaactgccctgttctctgtggctgtggacagtcgttgccagctg
catctgttgccctcacggcggagtgttcctgtgtggctcctgctcctgctgtgtgtcggg
cttattattgtgaccatcctgctgctccagagtgcctttccaggtttcctttag

DBGET integrated database retrieval system