KEGG   Homo sapiens (human): 10161Help
Entry
10161             CDS       T01001                                 

Gene name
LPAR6, ARWH1, HYPT8, LAH3, P2RY5, P2Y5
Definition
lysophosphatidic acid receptor 6
Orthology
K04273  
lysophosphatidic acid receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Pathways in cancer
Disease
H00667  
Woolly hair
H00784  
Localized autosomal recessive hypotrichosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    10161 (LPAR6)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10161 (LPAR6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10161 (LPAR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Lysophosphatidic acid [OT]
    10161 (LPAR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q14
AA seq 344 aa AA seqDB search
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcgttaacagctcccactgcttctataatgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggttaatatccaattgtgttgccatatac
attttcatctgcgtcctcaaagtccgaaatgaaactacaacttacatgattaacttggca
atgtcagacttgctttttgtttttactttacccttcaggattttttacttcacaacacgg
aattggccatttggagatttactttgtaagatttctgtgatgctgttttataccaacatg
tacggaagcattctgttcttaacctgtattagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactctaagaaccaaaagaaatgcaaagattgtttgcactggcgtg
tggttaactgtgatcggaggaagtgcacccgccgtttttgttcagtctacccactctcag
ggtaacaatgcctcagaagcctgctttgaaaattttccagaagccacatggaaaacatat
ctctcaaggattgtaattttcatcgaaatagtgggattttttattcctctaattttaaat
gtaacttgttctagtatggtgctaaaaactttaaccaaacctgttacattaagtagaagc
aaaataaacaaaactaaggttttaaaaatgatttttgtacatttgatcatattctgtttc
tgttttgttccttacaatatcaatcttattttatattctcttgtgagaacacaaacattt
gttaattgctcagtagtggcagcagtaaggacaatgtacccaatcactctctgtattgct
gtttccaactgttgttttgaccctatagtttactactttacatcggacacaattcagaat
tcaataaaaatgaaaaactggtctgtcaggagaagtgacttcagattctctgaagttcat
ggtgcagagaattttattcagcataacctacagaccttaaaaagtaagatatttgacaat
gaatctgctgcctga

DBGET integrated database retrieval system