KEGG   Homo sapiens (human): 10161Help
Entry
10161             CDS       T01001                                 

Gene name
LPAR6, ARWH1, LAH3, P2RY5, P2Y5
Definition
lysophosphatidic acid receptor 6
Orthology
K04273  
lysophosphatidic acid receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Disease
H00667  
Woolly hair
H00784  
Localized autosomal recessive hypotrichosis
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
13q14
AA seq 344 aa AA seqDB search
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcgttaacagctcccactgcttctataatgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggttaatatccaattgtgttgccatatac
attttcatctgcgtcctcaaagtccgaaatgaaactacaacttacatgattaacttggca
atgtcagacttgctttttgtttttactttacccttcaggattttttacttcacaacacgg
aattggccatttggagatttactttgtaagatttctgtgatgctgttttataccaacatg
tacggaagcattctgttcttaacctgtattagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactctaagaaccaaaagaaatgcaaagattgtttgcactggcgtg
tggttaactgtgatcggaggaagtgcacccgccgtttttgttcagtctacccactctcag
ggtaacaatgcctcagaagcctgctttgaaaattttccagaagccacatggaaaacatat
ctctcaaggattgtaattttcatcgaaatagtgggattttttattcctctaattttaaat
gtaacttgttctagtatggtgctaaaaactttaaccaaacctgttacattaagtagaagc
aaaataaacaaaactaaggttttaaaaatgatttttgtacatttgatcatattctgtttc
tgttttgttccttacaatatcaatcttattttatattctcttgtgagaacacaaacattt
gttaattgctcagtagtggcagcagtaaggacaatgtacccaatcactctctgtattgct
gtttccaactgttgttttgaccctatagtttactactttacatcggacacaattcagaat
tcaataaaaatgaaaaactggtctgtcaggagaagtgacttcagattctctgaagttcat
ggtgcagagaattttattcagcataacctacagaccttaaaaagtaagatatttgacaat
gaatctgctgcctga

DBGET integrated database retrieval system