KEGG   Homo sapiens (human): 10161Help
Entry
10161             CDS       T01001                                 

Gene name
LPAR6, ARWH1, HYPT8, LAH3, P2RY5, P2Y5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa05200  Pathways in cancer
Disease
H00667  Woolly hair
H00784  Localized autosomal recessive hypotrichosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    10161 (LPAR6)
   04151 PI3K-Akt signaling pathway
    10161 (LPAR6)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10161 (LPAR6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10161 (LPAR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Lysophosphatidic acid [OT]
    10161 (LPAR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx MscS_TM
Motif
Other DBs
NCBI-GeneID: 10161
NCBI-ProteinID: NP_001155969
OMIM: 609239
HGNC: 15520
Ensembl: ENSG00000139679
Vega: OTTHUMG00000016895
Pharos: P43657(Tchem)
UniProt: P43657 B3KVQ5 A0A024RDT2
LinkDB All DBs
Position
13q14.2
AA seq 344 aa AA seqDB search
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcgttaacagctcccactgcttctataatgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggttaatatccaattgtgttgccatatac
attttcatctgcgtcctcaaagtccgaaatgaaactacaacttacatgattaacttggca
atgtcagacttgctttttgtttttactttacccttcaggattttttacttcacaacacgg
aattggccatttggagatttactttgtaagatttctgtgatgctgttttataccaacatg
tacggaagcattctgttcttaacctgtattagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactctaagaaccaaaagaaatgcaaagattgtttgcactggcgtg
tggttaactgtgatcggaggaagtgcacccgccgtttttgttcagtctacccactctcag
ggtaacaatgcctcagaagcctgctttgaaaattttccagaagccacatggaaaacatat
ctctcaaggattgtaattttcatcgaaatagtgggattttttattcctctaattttaaat
gtaacttgttctagtatggtgctaaaaactttaaccaaacctgttacattaagtagaagc
aaaataaacaaaactaaggttttaaaaatgatttttgtacatttgatcatattctgtttc
tgttttgttccttacaatatcaatcttattttatattctcttgtgagaacacaaacattt
gttaattgctcagtagtggcagcagtaaggacaatgtacccaatcactctctgtattgct
gtttccaactgttgttttgaccctatagtttactactttacatcggacacaattcagaat
tcaataaaaatgaaaaactggtctgtcaggagaagtgacttcagattctctgaagttcat
ggtgcagagaattttattcagcataacctacagaccttaaaaagtaagatatttgacaat
gaatctgctgcctga

DBGET integrated database retrieval system