KEGG   Homo sapiens (human): 1030Help
Entry
1030              CDS       T01001                                 

Gene name
CDKN2B, CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Definition
cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Orthology
K04685  
cyclin-dependent kinase inhibitor 2B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
TGF-beta signaling pathway
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Disease
H00015  
Malignant pleural mesothelioma
H00036  
Osteosarcoma
H00409  
Type II diabetes mellitus
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
9p21
AA seq 138 aa AA seqDB search
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggagaacaagggcatgcccagtgggggcggcagcgatgagggtctggccagc
gccgcggcgcggggactagtggagaaggtgcgacagctcctggaagccggcgcggatccc
aacggagtcaaccgtttcgggaggcgcgcgatccaggtcatgatgatgggcagcgcccgc
gtggcggagctgctgctgctccacggcgcggagcccaactgcgcagaccctgccactctc
acccgaccggtgcatgatgctgcccgggagggcttcctggacacgctggtggtgctgcac
cgggccggggcgcggctggacgtgcgcgatgcctggggtcgtctgcccgtggacttggcc
gaggagcggggccaccgcgacgttgcagggtacctgcgcacagccacgggggactga

DBGET integrated database retrieval system