KEGG   Homo sapiens (human): 1030Help
Entry
1030              CDS       T01001                                 

Gene name
CDKN2B, CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Definition
cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Orthology
K04685  
cyclin-dependent kinase inhibitor 2B
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
TGF-beta signaling pathway
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Disease
H00015  
Malignant pleural mesothelioma
H00036  
Osteosarcoma
H00409  
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    1030 (CDKN2B)
   04068 FoxO signaling pathway
    1030 (CDKN2B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1030 (CDKN2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1030 (CDKN2B)
   05203 Viral carcinogenesis
    1030 (CDKN2B)
   05222 Small cell lung cancer
    1030 (CDKN2B)
  Infectious diseases
   05166 HTLV-I infection
    1030 (CDKN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
9p21
AA seq 138 aa AA seqDB search
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggagaacaagggcatgcccagtgggggcggcagcgatgagggtctggccagc
gccgcggcgcggggactagtggagaaggtgcgacagctcctggaagccggcgcggatccc
aacggagtcaaccgtttcgggaggcgcgcgatccaggtcatgatgatgggcagcgcccgc
gtggcggagctgctgctgctccacggcgcggagcccaactgcgcagaccctgccactctc
acccgaccggtgcatgatgctgcccgggagggcttcctggacacgctggtggtgctgcac
cgggccggggcgcggctggacgtgcgcgatgcctggggtcgtctgcccgtggacttggcc
gaggagcggggccaccgcgacgttgcagggtacctgcgcacagccacgggggactga

DBGET integrated database retrieval system