KEGG   Homo sapiens (human): 1030Help
Entry
1030              CDS       T01001                                 

Gene name
CDKN2B, CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Definition
(RefSeq) cyclin dependent kinase inhibitor 2B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04934  Cushing's syndrome
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
N00088  Amplified MYC to p15-cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00222  HTLV-I Tax to host-cell-protein inhibition
Disease
H00015  Malignant pleural mesothelioma
H00036  Osteosarcoma
H00409  Type II diabetes mellitus
H01463  Mycosis fungoides
H01556  Meningioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    1030 (CDKN2B)
   04068 FoxO signaling pathway
    1030 (CDKN2B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1030 (CDKN2B)
   04218 Cellular senescence
    1030 (CDKN2B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1030 (CDKN2B)
   05203 Viral carcinogenesis
    1030 (CDKN2B)
   05226 Gastric cancer
    1030 (CDKN2B)
   05222 Small cell lung cancer
    1030 (CDKN2B)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1030 (CDKN2B)
  Infectious diseases
   05166 HTLV-I infection
    1030 (CDKN2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank
Motif
Other DBs
NCBI-GeneID: 1030
NCBI-ProteinID: NP_004927
OMIM: 600431
HGNC: 1788
Ensembl: ENSG00000147883
Vega: OTTHUMG00000019691
Pharos: P42772(Tbio)
UniProt: P42772 K7PPU3
LinkDB All DBs
Position
9p21.3
AA seq 138 aa AA seqDB search
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA
EERGHRDVAGYLRTATGD
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggagaacaagggcatgcccagtgggggcggcagcgatgagggtctggccagc
gccgcggcgcggggactagtggagaaggtgcgacagctcctggaagccggcgcggatccc
aacggagtcaaccgtttcgggaggcgcgcgatccaggtcatgatgatgggcagcgcccgc
gtggcggagctgctgctgctccacggcgcggagcccaactgcgcagaccctgccactctc
acccgaccggtgcatgatgctgcccgggagggcttcctggacacgctggtggtgctgcac
cgggccggggcgcggctggacgtgcgcgatgcctggggtcgtctgcccgtggacttggcc
gaggagcggggccaccgcgacgttgcagggtacctgcgcacagccacgggggactga

DBGET integrated database retrieval system