KEGG   Homo sapiens (human): 10555Help
Entry
10555             CDS       T01001                                 

Gene name
AGPAT2, 1-AGPAT2, BSCL, BSCL1, LPAAB, LPAAT-beta
Definition
1-acylglycerol-3-phosphate O-acyltransferase 2 (EC:2.3.1.51)
Orthology
K13509  
lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Disease
H00419  
Congenital generalized lipodystrophy (CGL)
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
9q34.3
AA seq 246 aa AA seqDB search
MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK
RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENVPIVPVVYSSFSSFYN
TKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGS
GVQPAQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtggccgtgtctggccgcggcgctgctgttgctgctgctgctggtgcagctg
agccgcgcggccgagttctacgccaaggtcgccctgtactgcgcgctgtgcttcacggtg
tccgccgtggcctcgctcgtctgcctgctgcgccacggcggccggacggtggagaacatg
agcatcatcggctggttcgtgcgaagcttcaagtacttttacgggctccgcttcgaggtg
cgggacccgcgcaggctgcaggaggcccgtccctgtgtcatcgtctccaaccaccagagc
atcctggacatgatgggcctcatggaggtccttccggagcgctgcgtgcagatcgccaag
cgggagctgctcttcctggggcccgtgggcctcatcatgtacctcgggggcgtcttcttc
atcaaccggcagcgctctagcactgccatgacagtgatggccgacctgggcgagcgcatg
gtcagggagaacgtgcccatcgtccccgtggtgtactcttccttctcctccttctacaac
accaagaagaagttcttcacttcaggaacagtcacagtgcaggtgctggaagccatcccc
accagcggcctcactgcggcggacgtccctgcgctcgtggacacctgccaccgggccatg
aggaccaccttcctccacatctccaagaccccccaggagaacggggccactgcggggtct
ggcgtgcagccggcccagtag

DBGET integrated database retrieval system