KEGG   Homo sapiens (human): 10599Help
Entry
10599             CDS       T01001                                 

Gene name
SLCO1B1, HBLRR, LST-1, LST1, OATP-C, OATP1B1, OATP2, OATPC, SLC21A6
Definition
(RefSeq) solute carrier organic anion transporter family member 1B1
  KO
K05043  solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H00208  Hyperbilirubinemia
H02057  Rotor syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    10599 (SLCO1B1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC21/ASLCO: Organic anion transporter
   10599 (SLCO1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Motif
Other DBs
NCBI-GeneID: 10599
NCBI-ProteinID: NP_006437
OMIM: 604843
HGNC: 10959
Ensembl: ENSG00000134538
Vega: OTTHUMG00000169047
Pharos: Q9Y6L6(Tchem)
UniProt: Q9Y6L6 Q05CV5 A0A024RAU7
LinkDB All DBs
Position
12p12.1
AA seq 691 aa AA seqDB search
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaaatcaacatttgaataaaacagcagaggcacaaccttcagagaataagaaa
acaagatactgcaatggattgaagatgttcttggcagctctgtcactcagctttattgct
aagacactaggtgcaattattatgaaaagttccatcattcatatagaacggagatttgag
atatcctcttctcttgttggttttattgacggaagctttgaaattggaaatttgcttgtg
attgtatttgtgagttactttggatccaaactacatagaccaaagttaattggaatcggt
tgtttcattatgggaattggaggtgttttgactgctttgccacatttcttcatgggatat
tacaggtattctaaagaaactaatatcaattcatcagaaaattcaacatcgaccttatcc
acttgtttaattaatcaaattttatcactcaatagagcatcacctgagatagtgggaaaa
ggttgtttaaaggaatctgggtcatacatgtggatatatgtgttcatgggtaatatgctt
cgtggaataggggagactcccatagtaccattggggctttcttacattgatgatttcgct
aaagaaggacattcttctttgtatttaggtatattgaatgcaatagcaatgattggtcca
atcattggctttaccctgggatctctgttttctaaaatgtacgtggatattggatatgta
gatctaagcactatcaggataactcctactgattctcgatgggttggagcttggtggctt
aatttccttgtgtctggactattctccattatttcttccataccattctttttcttgccc
caaactccaaataaaccacaaaaagaaagaaaagcttcactgtctttgcatgtgctggaa
acaaatgatgaaaaggatcaaacagctaatttgaccaatcaaggaaaaaatattaccaaa
aatgtgactggttttttccagtcttttaaaagcatccttactaatcccctgtatgttatg
tttgtgcttttgacgttgttacaagtaagcagctatattggtgcttttacttatgtcttc
aaatacgtagagcaacagtatggtcagccttcatctaaggctaacatcttattgggagtc
ataaccatacctatttttgcaagtggaatgtttttaggaggatatatcattaaaaaattc
aaactgaacaccgttggaattgccaaattctcatgttttactgctgtgatgtcattgtcc
ttttacctattatattttttcatactctgtgaaaacaaatcagttgccggactaaccatg
acctatgatggaaataatccagtgacatctcatagagatgtaccactttcttattgcaac
tcagactgcaattgtgatgaaagtcaatgggaaccagtctgtggaaacaatggaataact
tacatctcaccctgtctagcaggttgcaaatcttcaagtggcaataaaaagcctatagtg
ttttacaactgcagttgtttggaagtaactggtctccagaacagaaattactcagcccat
ttgggtgaatgcccaagagatgatgcttgtacaaggaaattttacttttttgttgcaata
caagtcttgaatttatttttctctgcacttggaggcacctcacatgtcatgctgattgtt
aaaattgttcaacctgaattgaaatcacttgcactgggtttccactcaatggttatacga
gcactaggaggaattctagctccaatatattttggggctctgattgatacaacgtgtata
aagtggtccaccaacaactgtggcacacgtgggtcatgtaggacatataattccacatca
ttttcaagggtctacttgggcttgtcttcaatgttaagagtctcatcacttgttttatat
attatattaatttatgccatgaagaaaaaatatcaagagaaagatatcaatgcatcagaa
aatggaagtgtcatggatgaagcaaacttagaatccttaaataaaaataaacattttgtc
ccttctgctggggcagatagtgaaacacattgttaa

DBGET integrated database retrieval system