KEGG   Homo sapiens (human): 10599Help
Entry
10599             CDS       T01001                                 

Gene name
SLCO1B1, HBLRR, LST-1, LST1, OATP-C, OATP1B1, OATP2, OATPC, SLC21A6
Definition
solute carrier organic anion transporter family, member 1B1
Orthology
K05043  
solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Class
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12p
AA seq 691 aa AA seqDB search
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaaatcaacatttgaataaaacagcagaggcacaaccttcagagaataagaaa
acaagatactgcaatggattgaagatgttcttggcagctctgtcactcagctttattgct
aagacactaggtgcaattattatgaaaagttccatcattcatatagaacggagatttgag
atatcctcttctcttgttggttttattgacggaagctttgaaattggaaatttgcttgtg
attgtatttgtgagttactttggatccaaactacatagaccaaagttaattggaatcggt
tgtttcattatgggaattggaggtgttttgactgctttgccacatttcttcatgggatat
tacaggtattctaaagaaactaatatcaattcatcagaaaattcaacatcgaccttatcc
acttgtttaattaatcaaattttatcactcaatagagcatcacctgagatagtgggaaaa
ggttgtttaaaggaatctgggtcatacatgtggatatatgtgttcatgggtaatatgctt
cgtggaataggggagactcccatagtaccattggggctttcttacattgatgatttcgct
aaagaaggacattcttctttgtatttaggtatattgaatgcaatagcaatgattggtcca
atcattggctttaccctgggatctctgttttctaaaatgtacgtggatattggatatgta
gatctaagcactatcaggataactcctactgattctcgatgggttggagcttggtggctt
aatttccttgtgtctggactattctccattatttcttccataccattctttttcttgccc
caaactccaaataaaccacaaaaagaaagaaaagcttcactgtctttgcatgtgctggaa
acaaatgatgaaaaggatcaaacagctaatttgaccaatcaaggaaaaaatattaccaaa
aatgtgactggttttttccagtcttttaaaagcatccttactaatcccctgtatgttatg
tttgtgcttttgacgttgttacaagtaagcagctatattggtgcttttacttatgtcttc
aaatacgtagagcaacagtatggtcagccttcatctaaggctaacatcttattgggagtc
ataaccatacctatttttgcaagtggaatgtttttaggaggatatatcattaaaaaattc
aaactgaacaccgttggaattgccaaattctcatgttttactgctgtgatgtcattgtcc
ttttacctattatattttttcatactctgtgaaaacaaatcagttgccggactaaccatg
acctatgatggaaataatccagtgacatctcatagagatgtaccactttcttattgcaac
tcagactgcaattgtgatgaaagtcaatgggaaccagtctgtggaaacaatggaataact
tacatctcaccctgtctagcaggttgcaaatcttcaagtggcaataaaaagcctatagtg
ttttacaactgcagttgtttggaagtaactggtctccagaacagaaattactcagcccat
ttgggtgaatgcccaagagatgatgcttgtacaaggaaattttacttttttgttgcaata
caagtcttgaatttatttttctctgcacttggaggcacctcacatgtcatgctgattgtt
aaaattgttcaacctgaattgaaatcacttgcactgggtttccactcaatggttatacga
gcactaggaggaattctagctccaatatattttggggctctgattgatacaacgtgtata
aagtggtccaccaacaactgtggcacacgtgggtcatgtaggacatataattccacatca
ttttcaagggtctacttgggcttgtcttcaatgttaagagtctcatcacttgttttatat
attatattaatttatgccatgaagaaaaaatatcaagagaaagatatcaatgcatcagaa
aatggaagtgtcatggatgaagcaaacttagaatccttaaataaaaataaacattttgtc
ccttctgctggggcagatagtgaaacacattgttaa

DBGET integrated database retrieval system