KEGG   Homo sapiens (human): 10858Help
Entry
10858             CDS       T01001                                 

Gene name
CYP46A1, CP46, CYP46
Definition
cytochrome P450, family 46, subfamily A, polypeptide 1 (EC:1.14.13.98)
Orthology
K07440  
cholesterol 24(S)-hydroxylase [EC:1.14.13.98]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    10858 (CYP46A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.98  cholesterol 24-hydroxylase
     10858 (CYP46A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP46 family
   10858 (CYP46A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q32.1
AA seq 500 aa AA seqDB search
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVL
QDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERL
FGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSM
QDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQL
REVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
IAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKES
LRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA
PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLD
PVLCTLRPRGWQPAPPPPPC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgggctgctgctgctcggcagcgccgtcctgctcgccttcggcctctgctgc
accttcgtgcaccgcgctcgcagccgctacgagcacatccccgggccgccgcggcccagt
ttccttctaggacacctcccctgcttttggaaaaaggatgaggttggtggccgtgtgctc
caagatgtgtttttggattgggctaagaagtatggacctgttgtgcgggtcaacgtcttc
cacaaaacctcagtcatcgtcacgagtcctgagtcggttaagaagttcctgatgtcaacc
aagtacaacaaggactccaagatgtaccgtgcgctccagactgtgtttggtgagagactc
ttcggccaaggcttggtgtccgaatgcaactatgagcgctggcacaagcagcggagagtc
atagacctggccttcagccggagctccttggttagcttaatggaaacattcaacgagaag
gctgagcagctggtggagattctagaagccaaggcagatgggcagaccccagtgtccatg
caggacatgctgacctacaccgccatggacatcctggccaaggcagcttttgggatggag
accagtatgctgctgggtgcccagaagcctctgtcccaggcagtgaaacttatgttggag
ggaatcactgcgtcccgcaacactctggcaaagttcctgccagggaagaggaagcagctc
cgggaggtccgggagagcattcgcttcctgcgccaggtgggcagggactgggtccagcgc
cgccgggaagccctgaagaggggcgaggaggttcctgccgacatcctcacacagattctg
aaagctgaagagggagcccaggacgacgagggtctgctggacaacttcgtcaccttcttc
attgctggtcacgagacctctgccaaccacttggcgttcacagtgatggagctgtctcgc
cagccagagatcgtggcaaggctgcaggccgaggtggatgaggtcattggttctaagagg
tacctggatttcgaggacctggggagactgcagtacctgtcccaggtcctcaaagagtcg
ctgaggctgtacccaccagcatggggcacctttcgcctgctggaagaggagaccttgatt
gatggggtcagagtccccggcaacaccccgctcttgttcagcacctatgtcatggggcgg
atggacacatactttgaggacccgctgactttcaaccccgatcgcttcggccctggagca
cccaagccacggttcacctacttccccttctccctgggccaccgctcctgcatcgggcag
cagtttgctcagatggaggtgaaggtggtcatggcaaagctgctgcagaggctggagttc
cggctggtgcccgggcagcgcttcgggctgcaggagcaggccacactcaagccactggac
cccgtgctgtgcaccctgcggccccgcggctggcagcccgcacccccaccacccccctgc
tga

DBGET integrated database retrieval system