KEGG   Homo sapiens (human): 10858Help
Entry
10858             CDS       T01001                                 

Gene name
CYP46A1, CP46, CYP46
Definition
cytochrome P450, family 46, subfamily A, polypeptide 1 (EC:1.14.13.98)
Orthology
K07440  
cholesterol 24(S)-hydroxylase [EC:1.14.13.98]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q32.1
AA seq 500 aa AA seqDB search
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVL
QDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERL
FGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSM
QDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQL
REVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
IAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKES
LRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA
PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLD
PVLCTLRPRGWQPAPPPPPC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgggctgctgctgctcggcagcgccgtcctgctcgccttcggcctctgctgc
accttcgtgcaccgcgctcgcagccgctacgagcacatccccgggccgccgcggcccagt
ttccttctaggacacctcccctgcttttggaaaaaggatgaggttggtggccgtgtgctc
caagatgtgtttttggattgggctaagaagtatggacctgttgtgcgggtcaacgtcttc
cacaaaacctcagtcatcgtcacgagtcctgagtcggttaagaagttcctgatgtcaacc
aagtacaacaaggactccaagatgtaccgtgcgctccagactgtgtttggtgagagactc
ttcggccaaggcttggtgtccgaatgcaactatgagcgctggcacaagcagcggagagtc
atagacctggccttcagccggagctccttggttagcttaatggaaacattcaacgagaag
gctgagcagctggtggagattctagaagccaaggcagatgggcagaccccagtgtccatg
caggacatgctgacctacaccgccatggacatcctggccaaggcagcttttgggatggag
accagtatgctgctgggtgcccagaagcctctgtcccaggcagtgaaacttatgttggag
ggaatcactgcgtcccgcaacactctggcaaagttcctgccagggaagaggaagcagctc
cgggaggtccgggagagcattcgcttcctgcgccaggtgggcagggactgggtccagcgc
cgccgggaagccctgaagaggggcgaggaggttcctgccgacatcctcacacagattctg
aaagctgaagagggagcccaggacgacgagggtctgctggacaacttcgtcaccttcttc
attgctggtcacgagacctctgccaaccacttggcgttcacagtgatggagctgtctcgc
cagccagagatcgtggcaaggctgcaggccgaggtggatgaggtcattggttctaagagg
tacctggatttcgaggacctggggagactgcagtacctgtcccaggtcctcaaagagtcg
ctgaggctgtacccaccagcatggggcacctttcgcctgctggaagaggagaccttgatt
gatggggtcagagtccccggcaacaccccgctcttgttcagcacctatgtcatggggcgg
atggacacatactttgaggacccgctgactttcaaccccgatcgcttcggccctggagca
cccaagccacggttcacctacttccccttctccctgggccaccgctcctgcatcgggcag
cagtttgctcagatggaggtgaaggtggtcatggcaaagctgctgcagaggctggagttc
cggctggtgcccgggcagcgcttcgggctgcaggagcaggccacactcaagccactggac
cccgtgctgtgcaccctgcggccccgcggctggcagcccgcacccccaccacccccctgc
tga

DBGET integrated database retrieval system