KEGG   Homo sapiens (human): 10971Help
Entry
10971             CDS       T01001                                 

Gene name
YWHAQ, 14-3-3, 1C5, HS1
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Pathogenic Escherichia coli infection
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    10971 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    10971 (YWHAQ)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10971 (YWHAQ)
   04114 Oocyte meiosis
    10971 (YWHAQ)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10971 (YWHAQ)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10971 (YWHAQ)
   05161 Hepatitis B
    10971 (YWHAQ)
   05169 Epstein-Barr virus infection
    10971 (YWHAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10971 (YWHAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtgctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggtgattacttccggtaccttgctgaagttgcgtgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgag
attcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccatt
gctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggctgaaaactaa

DBGET integrated database retrieval system