KEGG   Homo sapiens (human): 1103Help
Entry
1103              CDS       T01001                                 

Gene name
CHAT, CHOACTASE, CMS1A, CMS1A2, CMS6
Definition
(RefSeq) choline O-acetyltransferase (EC:2.3.1.6)
  KO
K00623  
choline O-acetyltransferase [EC:2.3.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Disease
H00770  
Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    1103 (CHAT)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    1103 (CHAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     1103 (CHAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 748 aa AA seqDB search
MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPH
PRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKMA
AKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQ
QKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLIS
GVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPE
PEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSE
WAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANR
WYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAP
RRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQ
LAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLL
KDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQV
PTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRD
LCSLLPPTESKPLATKEKATRPSQGHQP
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggggctgaggacagcgaagaagagggggcttgggggaggggggaaatggaagagagag
gagggaggaggtacaagaggaaggagagaagtgcggccagcttgctttctccagtcgggt
ggccgcggggacccgggcgacgtcggaggccctgccgggaacccaggctgcagcccccac
ccccgcgctgcgacacgccccccaccccttccggctcacacccccgcccacactcctgag
tggtgcggtgcagcgtcggccgaggcagcagagccgaggagagcaggtccacacctctgc
atccctgcaccaggactcaccaagacgcccatcctggaaaaggtcccccgtaagatggca
gcaaaaactcccagcagtgaggagtctgggctgcccaaactgcccgtgcccccgctgcag
cagaccctggccacgtacctgcagtgcatgcgacacttggtgtctgaggagcagttcagg
aagagccaggccattgtgcagcagtttggggcccctggtggcctcggcgagaccctgcag
cagaaactcctggagcggcaggagaagacagccaactgggtgtctgagtactggctgaat
gacatgtatctcaacaaccgcctggccctgcctgtcaactccagccctgccgtgatcttt
gctcggcagcacttccctggcaccgatgaccagctgaggtttgcagccagcctcatctct
ggtgtactcagctacaaggccctgctggacagccactccattcccactgactgtgccaaa
ggccagctgtcagggcagcccctttgcatgaagcaatactatgggctcttctcctcctac
cggctccccggccatacccaggacacgctggtggctcagaacagcagcatcatgccggag
cctgagcacgtcatcgtagcctgctgcaatcagttctttgtcttggatgttgtcattaat
ttccgccgtctcagtgagggggatctgttcactcagttgagaaagatagtcaaaatggct
tccaacgaggacgagcgtttgcctccaattggcctgctgacgtctgacgggaggagcgag
tgggccgaggccaggacggtcctcgtgaaagactccaccaaccgggactcgctggacatg
attgagcgctgcatctgccttgtatgcctggacgcgccaggaggcgtggagctcagcgac
acccacagggcactccagctccttcacggcggaggctacagcaagaacggggccaatcgc
tggtacgacaagtccctgcagtttgtggtgggccgagacggcacctgcggtgtggtgtgc
gaacactccccattcgatggcatcgtcctggtgcagtgcactgagcatctgctcaagcac
atgacgcagagcagcaggaagctgatccgagcagactccgtcagcgagctccccgccccc
cggaggctgcggtggaaatgctccccggaaattcaaggccacttagcctcctcggcagaa
aaacttcaacgaatagtaaagaaccttgacttcattgtctataagtttgacaactatggg
aaaacattcattaagaagcagaaatgcagccctgatgccttcatccaggtggccctccag
ctggccttctacaggctccatcgaagactggtgcccacctacgagagcgcgtccatccgc
cgattccaggagggacgcgtggacaacatcagatcggccactccagaggcactggctttt
gtgagagccgtgactgaccacaaggctgctgtgccagcttctgagaagcttctgctcctg
aaggatgccatccgtgcccagactgcatacacagtcatggccataacagggatggccatt
gacaaccacctgctggcactgcgggagctggcccgggccatgtgcaaggagctgcccgag
atgttcatggatgaaacctacctgatgagcaaccggtttgtcctctccactagccaggtg
cccacaaccacggagatgttctgctgctatggtcctgtggtcccaaatgggtatggtgcc
tgctacaacccccagccagagaccatccttttctgcatctctagctttcacagctgcaaa
gagacttcttctagcaagtttgcaaaagctgtggaagaaagcctcattgacatgagagac
ctctgcagtctgctgccgcctactgagagcaagccattggcaacaaaggaaaaagccacg
aggcccagccagggacaccaaccttga

DBGET integrated database retrieval system