KEGG   Homo sapiens (human): 1120Help
Entry
1120              CDS       T01001                                 

Gene name
CHKB, CHETK, CHKL, CK, CKB, CKEKB, EK, EKB, MDCMC
Definition
choline kinase beta (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 395 aa AA seqDB search
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaggcgacagctgtggccggaagcggggctgttggcggctgcctggccaaa
gacggcttgcagcagtctaagtgcccggacactaccccaaaacggcggcgcgcctcgtcg
ctgtcgcgtgacgccgagcgccgagcctaccaatggtgccgggagtacttgggcggggcc
tggcgccgagtgcagcccgaggagctgagggtttaccccgtgagcggaggcctcagcaac
ctgctcttccgctgctcgctcccggaccacctgcccagcgttggcgaggagccccgggag
gtgcttctgcggctgtacggagccatcttgcagggcgtggactccctggtgctagaaagc
gtgatgttcgccatacttgcggagcggtcgctggggccccagctgtacggagtcttccca
gagggccggctggaacagtacatcccaagtcggccattgaaaactcaagagcttcgagag
ccagtgttgtcagcagccattgccacgaagatggcgcaatttcatggcatggagatgcct
ttcaccaaggagccccactggctgtttgggaccatggagcggtacctaaaacagatccag
gacctgcccccaactggcctccctgagatgaacctgctggagatgtacagcctgaaggat
gagatgggcaacctcaggaagttactagagtctaccccatcgccagtcgtcttctgccac
aatgacatccaggaagggaacatcttgctgctctcagagccagaaaatgctgacagcctc
atgctggtggacttcgagtacagcagttataactataggggctttgacattgggaaccat
ttttgtgagtgggtttatgattatactcacgaggaatggcctttctacaaagcaaggccc
acagactaccccactcaagaacagcagttgcattttattcgtcattacctggcagaggca
aagaaaggtgagaccctctcccaagaggagcagagaaaactggaagaagatttgctggta
gaagtcagtcggtatgctctggcatcccatttcttctggggtctgtggtccatcctccag
gcatccatgtccaccatagaatttggttacttggactatgcccagtctcggttccagttc
tacttccagcagaaggggcagctgaccagtgtccactcctcatcctga

DBGET integrated database retrieval system