KEGG   Homo sapiens (human): 11315Help
Entry
11315             CDS       T01001                                 

Gene name
PARK7, DJ-1, DJ1, HEL-S-67p
Definition
parkinson protein 7
Orthology
K05687  
protein DJ-1
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1p36.23
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggctaaaggagcagaggaaatggagacggtc
atccctgtagatgtcatgaggcgagctgggattaaggtcaccgttgcaggcctggctgga
aaagacccagtacagtgtagccgtgatgtggtcatttgtcctgatgccagccttgaagat
gcaaaaaaagagggaccatatgatgtggtggttctaccaggaggtaatctgggcgcacag
aatttatctgagtctgctgctgtgaaggagatactgaaggagcaggaaaaccggaagggc
ctgatagccgccatctgtgcaggtcctactgctctgttggctcatgaaataggttttgga
agtaaagttacaacacaccctcttgctaaagacaaaatgatgaatggaggtcattacacc
tactctgagaatcgtgtggaaaaagacggcctgattcttacaagccgggggcctgggacc
agcttcgagtttgcgcttgcaattgttgaagccctgaatggcaaggaggtggcggctcaa
gtgaaggctccacttgttcttaaagactag

DBGET integrated database retrieval system