KEGG   Homo sapiens (human): 113235Help
Entry
113235            CDS       T01001                                 

Gene name
SLC46A1, G21, HCP1, PCFT
Definition
solute carrier family 46 (folate transporter), member 1
Orthology
K14613  
MFS transporter, PCFT/HCP family, solute carrier family 46 (folate transporter), member 1/3
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Mineral absorption
Disease
H01252  
Hereditary folate malabsorption (HFM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    113235 (SLC46A1)
   04978 Mineral absorption
    113235 (SLC46A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
17q11.2
AA seq 431 aa AA seqDB search
MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT
RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLA
SLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFR
MALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKST
RLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWD
SKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFT
GALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLLGAGLLLIPAVLIGMLEKADP
HLEFQQFPQSP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaggggagcgcgagccccccggaaaagccccgcgcccgccctgcggctgccgtgctg
tgccggggcccggtagagccgctggtcttcctggccaactttgccttggtcctgcagggc
ccgctcaccacgcagtatctgtggcaccgcttcagcgccgacctcggctacaatggcacc
cgccaaagggggggctgcagcaaccgcagcgcggaccccaccatgcaggaagtggagacc
cttacctcccactggaccctctacatgaacgtgggcggcttcctggtggggctcttctcg
tccaccctgctgggagcttggagcgacagtgtgggccgccgcccgctgctagtgctggcc
tcgctgggcctgctgctccaggccctagtgtccgtttttgtggtgcagctgcagctccac
gtcggctacttcgtgctgggtcgcatcctttgtgccctcctcggcgacttcggtggcctt
ctggctgctagctttgcgtccgtggcagatgtcagctccagtcgcagccgcaccttccgg
atggccctgctggaagccagcatcggggtggctgggatgctggcaagcctcctcgggggc
cactggctccgggcccagggttatgccaaccccttctggctggccttggccttgctgata
gccatgactctctatgcagctttctgctttggtgagaccttaaaggagccaaagtccacc
cggctcttcacgttccgtcaccaccgatccattgtccagctctatgtggctcccgcccca
gagaagtccaggaaacatttagccctctactcactggccatcttcgtggtgatcactgtg
cactttggggcccaggacatcttaaccctttatgaactaagcacacccctctgctgggac
tccaaactaatcggctatggttctgcagctcagcatctcccctacctcaccagcctgctg
gccctgaagctcctgcagtactgcctggccgatgcctgggtagctgagatcggcctggcc
ttcaacatcctggggatggtggtctttgcctttgccactatcacgcctctcatgttcaca
ggtgctctcttttctgctgtggcctgtgtgaatagcctggccatgctgacggcctccggc
atcttcaactcactctacccagccactctgaactttatgaaggggttccccttcctcctg
ggagctggcctcctgctcatcccggctgttctgattgggatgctggaaaaggctgatcct
cacctcgagttccagcagtttccccagagcccctga

DBGET integrated database retrieval system