KEGG   Homo sapiens (human): 113278Help
Entry
113278            CDS       T01001                                 

Gene name
SLC52A3, BVVLS, BVVLS1, C20orf54, RFT2, RFVT3, bA371L19.1, hRFT2
Definition
solute carrier family 52 (riboflavin transporter), member 3
Orthology
K14620  
riboflavin transporter 2
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H00841  
Infantile progressive bulbar palsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    113278 (SLC52A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
20p13
AA seq 469 aa AA seqDB search
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDC
TSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPV
PTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFV
LQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
AFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSL
LFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctgatgcacctgctggtctgcgtcttcggaatgggctcctgggtgaccatc
aatgggctctgggtagagctgcccctgctggtgatggagctgcccgagggctggtacctg
ccctcctacctcacggtggtcatccagctggccaacatcgggcccctcctggtcaccctg
ctccatcacttccggcccagctgcctttccgaagtgcccatcatcttcaccctgctgggc
gtgggaaccgtcacctgcatcatctttgccttcctctggaatatgacctcctgggtgctg
gacggccaccacagcatcgccttcttggtcctcaccttcttcctggccctggtggactgc
acctcttcagtgaccttcctgccgttcatgagccggctgcccacctactacctcaccacc
ttctttgtgggtgaaggactcagcggcctcttgcccgccctggtggctcttgcccagggc
tccggtctcactacctgcgtcaatgtcactgagatatcagacagcgtaccaagccctgta
cccacgagggagactgacatcgcacagggagttcccagagctttggtgtccgccctcccc
ggaatggaagcacccttgtcccacctggagagccgctaccttcccgcccacttctcaccc
ctggtcttcttcctcctcctatccatcatgatggcctgctgcctcgtggcgttctttgtc
ctccagcgtcaacccaggtgctgggaggcttccgtggaagacctcctcaatgaccaggtc
accctccactccatccggccgcgggaagagaatgacttgggccctgcaggcacggtggac
agcagccagggccaggggtatctagaggagaaagcagccccctgctgcccggcgcacctg
gccttcatctataccctggtggccttcgtcaacgcgctcaccaacggcatgctgccctct
gtgcagacctactcctgcctgtcctatgggccagttgcctaccacctggctgccaccctc
agcattgtggccaaccctcttgcctcgttggtctccatgttcctgcctaacaggtctctg
ctgttcctgggggtcctctccgtgcttgggacctgctttgggggctacaacatggccatg
gcggtgatgagcccctgccccctcttgcagggccactggggtggggaagtcctcattgtg
gcctcgtgggtgcttttcagcggctgcctcagttacgtcaaggtgatgctgggcgtggtc
ctgcgcgacctcagccgcagcgccctcttgtggtgcggggcggcggtgcagctgggctcg
ctgctcggagcgctgctcatgttccctctggtcaacgtgctgcggctcttctcgtccgcg
gacttctgcaatctgcactgtccagcctag

DBGET integrated database retrieval system