KEGG   Homo sapiens (human): 1134Help
Entry
1134              CDS       T01001                                 

Gene name
CHRNA1, ACHRA, ACHRD, CHRNA, CMS1A, CMS1B, CMS2A, FCCMS, SCCMS
Definition
(RefSeq) cholinergic receptor nicotinic alpha 1 subunit
  KO
K04803  nicotinic acetylcholine receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999
Atracurium (DG00771): D00758
Cisatracurium: D00759
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Gallamine: D02292
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611
Mivacurium chloride: D00763
Pancuronium (DG00769): D00492
Pipecuronium bromide: D00764
Rapacuronium bromide: D05703
Rocuronium bromide: D00765
Suxamethonium (DG00768): D00766 D02275
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1134 (CHRNA1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1134 (CHRNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Claudin_2
Motif
Other DBs
NCBI-GeneID: 1134
NCBI-ProteinID: NP_001034612
OMIM: 100690
HGNC: 1955
Ensembl: ENSG00000138435
Vega: OTTHUMG00000132357
Pharos: P02708(Tclin)
UniProt: P02708 Q53SH4
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2q31.1
AA seq 482 aa AA seqDB search
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggagccctggcctctcctcctgctctttagcctttgctcagctggcctcgtcctgggc
tccgaacatgagacccgtctggtggcaaagctatttaaagactacagcagcgtggtgcgg
ccagtggaagaccaccgccaggtcgtggaggtcaccgtgggcctgcagctgatacagctc
atcaatgtggatgaagtaaatcagatcgtgacaaccaatgtgcgtctgaaacagggtgac
atggtagatctgccacgccccagctgcgtgactttgggagttcctttgttttctcatctg
cagaatgagcaatgggtggattacaacctaaaatggaatccagatgactatggcggtgtg
aaaaaaattcacattccttcagaaaagatctggcgcccagaccttgttctctataacaat
gcagatggtgactttgctattgtcaagttcaccaaagtgctcctgcagtacactggccac
atcacgtggacacctccagccatctttaaaagctactgtgagatcatcgtcacccacttt
ccctttgatgaacagaactgcagcatgaagctgggcacctggacctacgacggctctgtc
gtggccatcaacccggaaagcgaccagccagacctgagcaacttcatggagagcggggag
tgggtgatcaaggagtcccggggctggaagcactccgtgacctattcctgctgccccgac
accccctacctggacatcacctaccacttcgtcatgcagcgcctgcccctctacttcatc
gtcaacgtcatcatcccctgcctgctcttctccttcttaactggcctggtattctacctg
cccacagactcaggggagaagatgactctgagcatctctgtcttactgtctttgactgtg
ttccttctggtcatcgtggagctgatcccctccacgtccagtgctgtgcccttgattgga
aaatacatgctgttcaccatggtgttcgtcattgcctccatcatcatcactgtcatcgtc
atcaacacacaccaccgctcacccagcacccatgtcatgcccaactgggtgcggaaggtt
tttatcgacactatcccaaatatcatgtttttctccacaatgaaaagaccatccagagaa
aagcaagacaaaaagatttttacagaagacattgatatctctgacatttctggaaagcca
gggcctccacccatgggcttccactctcccctgatcaaacaccccgaggtgaaaagtgcc
atcgagggcatcaagtacatcgcagagaccatgaagtcagaccaggagtctaacaatgcg
gcggcagagtggaagtacgttgcaatggtgatggaccacatactcctcggagtcttcatg
cttgtttgcatcatcggaaccctagccgtgtttgcaggtcgactcattgaattaaatcag
caaggatga

DBGET integrated database retrieval system