KEGG   Homo sapiens (human): 1134Help
Entry
1134              CDS       T01001                                 

Gene name
CHRNA1, ACHRA, ACHRD, CHRNA, CMS2A, FCCMS, SCCMS
Definition
cholinergic receptor, nicotinic, alpha 1 (muscle)
Orthology
K04803  
nicotinic acetylcholine receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
H00986  
Multiple pterygium syndrome
Drug target
Trimetaphan: 
Mecamylamine: 
Tubocurarine: 
Dimethyltubocurarine: 
Suxamethonium: 
Pancuronium: 
Gallamine: 
Vecuronium: 
Atracurium: 
Pipecuronium bromide: 
Doxacurium chloride: 
Rocuronium bromide: 
Mivacurium chloride: 
Cisatracurium: 
Acetylcholine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1134 (CHRNA1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1134 (CHRNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2q31.1
AA seq 457 aa AA seqDB search
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDF
AIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKK
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWK
YVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagccctggcctctcctcctgctctttagcctttgctcagctggcctcgtcctgggc
tccgaacatgagacccgtctggtggcaaagctatttaaagactacagcagcgtggtgcgg
ccagtggaagaccaccgccaggtcgtggaggtcaccgtgggcctgcagctgatacagctc
atcaatgtggatgaagtaaatcagatcgtgacaaccaatgtgcgtctgaaacagcaatgg
gtggattacaacctaaaatggaatccagatgactatggcggtgtgaaaaaaattcacatt
ccttcagaaaagatctggcgcccagaccttgttctctataacaatgcagatggtgacttt
gctattgtcaagttcaccaaagtgctcctgcagtacactggccacatcacgtggacacct
ccagccatctttaaaagctactgtgagatcatcgtcacccactttccctttgatgaacag
aactgcagcatgaagctgggcacctggacctacgacggctctgtcgtggccatcaacccg
gaaagcgaccagccagacctgagcaacttcatggagagcggggagtgggtgatcaaggag
tcccggggctggaagcactccgtgacctattcctgctgccccgacaccccctacctggac
atcacctaccacttcgtcatgcagcgcctgcccctctacttcatcgtcaacgtcatcatc
ccctgcctgctcttctccttcttaactggcctggtattctacctgcccacagactcaggg
gagaagatgactctgagcatctctgtcttactgtctttgactgtgttccttctggtcatc
gtggagctgatcccctccacgtccagtgctgtgcccttgattggaaaatacatgctgttc
accatggtgttcgtcattgcctccatcatcatcactgtcatcgtcatcaacacacaccac
cgctcacccagcacccatgtcatgcccaactgggtgcggaaggtttttatcgacactatc
ccaaatatcatgtttttctccacaatgaaaagaccatccagagaaaagcaagacaaaaag
atttttacagaagacattgatatctctgacatttctggaaagccagggcctccacccatg
ggcttccactctcccctgatcaaacaccccgaggtgaaaagtgccatcgagggcatcaag
tacatcgcagagaccatgaagtcagaccaggagtctaacaatgcggcggcagagtggaag
tacgttgcaatggtgatggaccacatactcctcggagtcttcatgcttgtttgcatcatc
ggaaccctagccgtgtttgcaggtcgactcattgaattaaatcagcaaggatga

DBGET integrated database retrieval system