KEGG   Homo sapiens (human): 1158Help
Entry
1158              CDS       T01001                                 

Gene name
CKM, CKMM, M-CK
Definition
creatine kinase, muscle (EC:2.7.3.2)
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    1158 (CKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     1158 (CKM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   1158 (CKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 381 aa AA seqDB search
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccattcggtaacacccacaacaagttcaagctgaattacaagcctgaggaggagtac
cccgacctcagcaaacataacaaccacatggccaaggtactgacccttgaactctacaag
aagctgcgggacaaggagactccatctggcttcactgtagacgatgtcatccagacagga
gtggacaacccaggtcaccccttcatcatgaccgtgggctgcgtggctggtgatgaggag
tcctacgaagttttcaaggaactctttgaccccatcatctcggatcgccacgggggctac
aaacccactgacaagcacaagactgacctcaaccatgaaaacctcaagggtggagacgac
ctggaccctaactacgtgctcagcagccgcgtccgcactggccgcagcatcaagggctac
acgttgcccccacactgctcccgtggcgagcgccgggcggtggagaagctctctgtggaa
gctctcaacagcctgacgggcgagttcaaagggaagtactaccctctgaagagcatgacg
gagaaggagcagcagcagctcatcgatgaccacttcctgttcgacaagcccgtgtccccg
ctgctgctggcctcaggcatggcccgcgactggcccgacgcccgtggcatctggcacaat
gacaacaagagcttcctggtgtgggtgaacgaggaggatcacctccgggtcatctccatg
gagaaggggggcaacatgaaggaggttttccgccgcttctgcgtagggctgcagaagatt
gaggagatctttaagaaagctggccaccccttcatgtggaaccagcacctgggctacgtg
ctcacctgcccatccaacctgggcactgggctgcgtggaggcgtgcatgtgaagctggcg
cacctgagcaagcaccccaagttcgaggagatcctcacccgcctgcgtctgcagaagagg
ggtacaggtggcgtggacacagctgccgtgggctcagtatttgacgtgtccaacgctgat
cggctgggctcgtccgaagtagaacaggtgcagctggtggtggatggtgtgaagctcatg
gtggaaatggagaagaagttggagaaaggccagtccattgacgacatgatccccgcccag
aagtag

DBGET integrated database retrieval system