KEGG   Homo sapiens (human): 116Help
Entry
116               CDS       T01001                                 

Gene name
ADCYAP1, PACAP
Definition
(RefSeq) adenylate cyclase activating polypeptide 1
  KO
K05262  adenylate cyclase activating polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    116 (ADCYAP1)
   04924 Renin secretion
    116 (ADCYAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2
Motif
Other DBs
NCBI-GeneID: 116
NCBI-ProteinID: NP_001093203
OMIM: 102980
HGNC: 241
Ensembl: ENSG00000141433
Vega: OTTHUMG00000131479
Pharos: P18509(Tbio)
UniProt: P18509
LinkDB All DBs
Structure
PDB: 

Jmol
Position
18p11.32
AA seq 176 aa AA seqDB search
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcgaggctggccctgctggtctatgggataatcatgcacagc
agcgtctacagctcacctgccgccgccggactccggttccccgggatcaggccagaggaa
gaggcgtacggcgaggacggaaacccgctgccagacttcgatggctcggagccgccgggc
gcagggagccccgcctccgcgccgcgcgccgccgccgcctggtaccgcccggccgggaga
agagatgtcgcccacgggatccttaacgaggcctaccgcaaagtgctggaccagctgtcc
gccgggaagcacctgcagtcgctcgtggcccggggcgtgggtgggagcctcggcggcggc
gcgggggacgacgcggagccgctctccaagcgccactcggacgggatcttcacggacagc
tacagccgctaccggaaacaaatggctgtcaagaaatacttggcggccgtcctagggaag
aggtataaacaaagggttaaaaacaaaggacgccgaatagcttatttgtag

DBGET integrated database retrieval system