KEGG   Homo sapiens (human): 116Help
Entry
116               CDS       T01001                                 

Gene name
ADCYAP1, PACAP
Definition
adenylate cyclase activating polypeptide 1 (pituitary)
Orthology
K05262  
adenylate cyclase activating polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116 (ADCYAP1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    116 (ADCYAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
18p11
AA seq 176 aa AA seqDB search
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcgaggctggccctgctggtctatgggataatcatgcacagc
agcgtctacagctcacctgccgccgccggactccggttccccgggatcaggccagaggaa
gaggcgtacggcgaggacggaaacccgctgccagacttcgatggctcggagccgccgggc
gcagggagccccgcctccgcgccgcgcgccgccgccgcctggtaccgcccggccgggaga
agagatgtcgcccacgggatccttaacgaggcctaccgcaaagtgctggaccagctgtcc
gccgggaagcacctgcagtcgctcgtggcccggggcgtgggtgggagcctcggcggcggc
gcgggggacgacgcggagccgctctccaagcgccactcggacgggatcttcacggacagc
tacagccgctaccggaaacaaatggctgtcaagaaatacttggcggccgtcctagggaag
aggtataaacaaagggttaaaaacaaaggacgccgaatagcttatttgtag

DBGET integrated database retrieval system