KEGG   Homo sapiens (human): 116519Help
Entry
116519            CDS       T01001                                 

Gene name
APOA5, APOAV, RAP3
Definition
apolipoprotein A-V
Orthology
K09025  
apolipoprotein A-V
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Disease
H00157  
Hyperlipoproteinemia, type V
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    116519 (APOA5)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Others
  116519 (APOA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11q23
AA seq 366 aa AA seqDB search
MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSL
EQDLNNMNKFLEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGW
NLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRV
VHHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLSRCVQVLSRKLTLKAK
ALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFT
RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGH
SHLGDP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatggctgccgtgctcacctgggctctggctcttctttcagcgttttcggcc
acccaggcacggaaaggcttctgggactacttcagccagaccagcggggacaaaggcagg
gtggagcagatccatcagcagaagatggctcgcgagcccgcgaccctgaaagacagcctt
gagcaagacctcaacaatatgaacaagttcctggaaaagctgaggcctctgagtgggagc
gaggctcctcggctcccacaggacccggtgggcatgcggcggcagctgcaggaggagttg
gaggaggtgaaggctcgcctccagccctacatggcagaggcgcacgagctggtgggctgg
aatttggagggcttgcggcagcaactgaagccctacacgatggatctgatggagcaggtg
gccctgcgcgtgcaggagctgcaggagcagttgcgcgtggtgggggaagacaccaaggcc
cagttgctggggggcgtggacgaggcttgggctttgctgcagggactgcagagccgcgtg
gtgcaccacaccggccgcttcaaagagctcttccacccatacgccgagagcctggtgagc
ggcatcgggcgccacgtgcaggagctgcaccgcagtgtggctccgcacgcccccgccagc
cccgcgcgcctcagtcgctgcgtgcaggtgctctcccggaagctcacgctcaaggccaag
gccctgcacgcacgcatccagcagaacctggaccagctgcgcgaagagctcagcagagcc
tttgcaggcactgggactgaggaaggggccggcccggacccccagatgctctccgaggag
gtgcgccagcgacttcaggctttccgccaggacacctacctgcagatagctgccttcact
cgcgccatcgaccaggagactgaggaggtccagcagcagctggcgccacctccaccaggc
cacagtgccttcgccccagagtttcaacaaacagacagtggcaaggttctgagcaagctg
caggcccgtctggatgacctgtgggaagacatcactcacagccttcatgaccagggccac
agccatctgggggacccctga

DBGET integrated database retrieval system