KEGG   Homo sapiens (human): 117247Help
Entry
117247            CDS       T01001                                 

Gene name
SLC16A10, MCT10, PRO0813, TAT1
Definition
solute carrier family 16 (aromatic amino acid transporter), member 10
Orthology
K08187  
MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 10
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone signaling pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    117247 (SLC16A10)
  Digestive system
   04974 Protein digestion and absorption
    117247 (SLC16A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
6q21-q22
AA seq 515 aa AA seqDB search
MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE
PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL
SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC
SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF
MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI
PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY
LQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI
SKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccaggaggagccggactccgcgcggggcacgagcgaggcgcagccgctc
ggccccgcgcccacgggggccgctccgccgcccggcccgggaccctcggacagccccgag
gcggctgtcgagaaggtggaggtggagctggcggggccggcgaccgcggagccccatgag
ccccccgaaccccccgagggcggctggggctggctggtgatgctggcggccatgtggtgc
aacgggtcggtgttcggcatccagaacgcttgcggggtgctcttcgtgtccatgctggaa
accttcggctccaaagacgatgacaagatggtctttaagacagcatgggtaggttctctc
tccatggggatgattttcttttgctgcccaatagtcagcgtcttcacagacctatttggt
tgtcggaaaacagctgtcgtgggtgctgctgttggatttgttgggctcatgtccagttct
tttgtaagttccatcgagcctctgtaccttacctatggaatcatatttgcctgcggctgc
tcctttgcataccagccttcattggtcattttgggacactatttcaagaagcgccttgga
ctggtgaatggcattgtcactgctggcagcagtgtcttcacaatcctgctgcctttgctc
ttaagggttctgattgacagcgtgggcctcttttacacattgagggtgctctgcatcttc
atgtttgttctctttctggctggctttacttaccgacctcttgctaccagtaccaaagat
aaagagagtggaggtagcggatcctccctcttttccaggaaaaagttcagtcctccaaaa
aaaattttcaattttgccatcttcaaggtgacagcttatgcagtgtgggcagttggaata
ccacttgcactttttggatactttgtgccttatgttcacttgatgaaacatgtaaatgaa
agatttcaagatgaaaaaaataaagaggttgttctcatgtgcattggcgtcacttcagga
gttggacgactgctctttggccggattgcagattatgtgcctggtgtgaagaaggtttat
ctacaggtactctcctttttcttcattggtctgatgtccatgatgattcctctgtgtagc
atctttggggccctcattgctgtgtgcctcatcatgggtctcttcgatggatgcttcatt
tccattatggctcccatagcctttgagttagttggtgcccaggatgtctcccaagcaatt
ggatttctgctcggattcatgtctatacccatgactgttggcccacccattgcagggtta
cttcgtgacaaactgggctcctatgatgtggcattctacctcgctggagtccctcccctt
attggaggtgctgtgctttgttttatcccgtggatccatagtaagaagcaaagagagatc
agtaaaaccactggaaaagaaaagatggagaaaatgttggaaaaccagaactctctgctg
tcaagttcatctggaatgttcaagaaagaatctgactctattatttaa

DBGET integrated database retrieval system