KEGG   Homo sapiens (human): 1200Help
Entry
1200              CDS       T01001                                 

Gene name
TPP1, CLN2, LPIC, SCAR7, TPP-1
Definition
tripeptidyl peptidase I (EC:3.4.14.9)
Orthology
K01279  
tripeptidyl-peptidase I [EC:3.4.14.9]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1200 (TPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.9  tripeptidyl-peptidase I
     1200 (TPP1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S53
   1200 (TPP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1200 (TPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11p15
AA seq 563 aa AA seqDB search
MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVER
LSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFL
TCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTS
SLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDL
AQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG
QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGD
SGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS
YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPV
FGGILSLINEHRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGP
GWDPVTGWGTPNFPALLKTLLNP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggactccaagcctgcctcctagggctctttgccctcatcctctctggcaaatgcagt
tacagcccggagcccgaccagcggaggacgctgcccccaggctgggtgtccctgggccgt
gcggaccctgaggaagagctgagtctcacctttgccctgagacagcagaatgtggaaaga
ctctcggagctggtgcaggctgtgtcggatcccagctctcctcaatacggaaaatacctg
accctagagaatgtggctgatctggtgaggccatccccactgaccctccacacggtgcaa
aaatggctcttggcagccggagcccagaagtgccattctgtgatcacacaggactttctg
acttgctggctgagcatccgacaagcagagctgctgctccctggggctgagtttcatcac
tatgtgggaggacctacggaaacccatgttgtaaggtccccacatccctaccagcttcca
caggccttggccccccatgtggactttgtggggggactgcaccgttttcccccaacatca
tccctgaggcaacgtcctgagccgcaggtgacagggactgtaggcctgcatctgggggta
accccctctgtgatccgtaagcgatacaacttgacctcacaagacgtgggctctggcacc
agcaataacagccaagcctgtgcccagttcctggagcagtatttccatgactcagacctg
gctcagttcatgcgcctcttcggtggcaactttgcacatcaggcatcagtagcccgtgtg
gttggacaacagggccggggccgggccgggattgaggccagtctagatgtgcagtacctg
atgagtgctggtgccaacatctccacctgggtctacagtagccctggccggcatgaggga
caggagcccttcctgcagtggctcatgctgctcagtaatgagtcagccctgccacatgtg
catactgtgagctatggagatgatgaggactccctcagcagcgcctacatccagcgggtc
aacactgagctcatgaaggctgccgctcggggtctcaccctgctcttcgcctcaggtgac
agtggggccgggtgttggtctgtctctggaagacaccagttccgccctaccttccctgcc
tccagcccctatgtcaccacagtgggaggcacatccttccaggaacctttcctcatcaca
aatgaaattgttgactatatcagtggtggtggcttcagcaatgtgttcccacggccttca
taccaggaggaagctgtaacgaagttcctgagctctagcccccacctgccaccatccagt
tacttcaatgccagtggccgtgcctacccagatgtggctgcactttctgatggctactgg
gtggtcagcaacagagtgcccattccatgggtgtccggaacctcggcctctactccagtg
tttggggggatcctatccttgatcaatgagcacaggatccttagtggccgcccccctctt
ggctttctcaacccaaggctctaccagcagcatggggcaggactctttgatgtaacccgt
ggctgccatgagtcctgtctggatgaagaggtagagggccagggtttctgctctggtcct
ggctgggatcctgtaacaggctggggaacacccaacttcccagctttgctgaagactcta
ctcaacccctga

DBGET integrated database retrieval system