KEGG   Homo sapiens (human): 1234Help
Entry
1234              CDS       T01001                                 

Gene name
CCR5, CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
Definition
chemokine (C-C motif) receptor 5 (gene/pseudogene)
Orthology
K04180  
C-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Toxoplasmosis
Viral carcinogenesis
Disease
H01360  
Allergic rhinitis
Drug target
Maraviroc: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1234 (CCR5)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1234 (CCR5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    1234 (CCR5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1234 (CCR5)
  Infectious diseases
   05145 Toxoplasmosis
    1234 (CCR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    1234 (CCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1234 (CCR5)
Cellular antigens [BR:hsa04090]
 Proteins
  1234 (CCR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 352 aa AA seqDB search
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgc
caaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccagg
acggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtct
ctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaact
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcag
gtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system