KEGG   Homo sapiens (human): 1278Help
Entry
1278              CDS       T01001                                 

Gene name
COL1A2, OI4
Definition
collagen, type I, alpha 2
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Disease
H00506  
Osteogenesis imperfecta
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1278 (COL1A2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1278 (COL1A2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1278 (COL1A2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    1278 (COL1A2)
  Digestive system
   04974 Protein digestion and absorption
    1278 (COL1A2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    1278 (COL1A2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1278 (COL1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7q22.1
AA seq 1366 aa AA seqDB search
MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTG
PPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEP
GEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIR
GHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV
GPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNP
GANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNK
GEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPP
GSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPI
GPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ
GGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA
GPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEP
GLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPA
GPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDG
GPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPP
GFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIA
GPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAA
GAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLP
GLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIR
GPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLK
SLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG
ETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLL
ANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKK
TNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactttgttgctgcttgcagtaaccttatgcctagca
acatgccaatctttacaagaggaaactgtaagaaagggcccagccggagatagaggacca
cgtggagaaaggggtccaccaggccccccaggcagagatggtgaagatggtcccacaggc
cctcctggtccacctggtcctcctggcccccctggtctcggtgggaactttgctgctcag
tatgatggaaaaggagttggacttggccctggaccaatgggcttaatgggacctagaggc
ccacctggtgcagctggagccccaggccctcaaggtttccaaggacctgctggtgagcct
ggtgaacctggtcaaactggtcctgcaggtgctcgtggtccagctggccctcctggcaag
gctggtgaagatggtcaccctggaaaacccggacgacctggtgagagaggagttgttgga
ccacagggtgctcgtggtttccctggaactcctggacttcctggcttcaaaggcattagg
ggacacaatggtctggatggattgaagggacagcccggtgctcctggtgtgaagggtgaa
cctggtgcccctggtgaaaatggaactccaggtcaaacaggagcccgtgggcttcctggt
gagagaggacgtgttggtgcccctggcccagctggtgcccgtggcagtgatggaagtgtg
ggtcccgtgggtcctgctggtcccattgggtctgctggccctccaggcttcccaggtgcc
cctggccccaagggtgaaattggagctgttggtaacgctggtcctgctggtcccgccggt
ccccgtggtgaagtgggtcttccaggcctctccggccccgttggacctcctggtaatcct
ggagcaaacggccttactggtgccaagggtgctgctggccttcccggcgttgctggggct
cccggcctccctggaccccgcggtattcctggccctgttggtgctgccggtgctactggt
gccagaggacttgttggtgagcctggtccagctggctccaaaggagagagcggtaacaag
ggtgagcccggctctgctgggccccaaggtcctcctggtcccagtggtgaagaaggaaag
agaggccctaatggggaagctggatctgccggccctccaggacctcctgggctgagaggt
agtcctggttctcgtggtcttcctggagctgatggcagagctggcgtcatgggccctcct
ggtagtcgtggtgcaagtggccctgctggagtccgaggacctaatggagatgctggtcgc
cctggggagcctggtctcatgggacccagaggtcttcctggttcccctggaaatatcggc
cccgctggaaaagaaggtcctgtcggcctccctggcatcgacggcaggcctggcccaatt
ggcccagctggagcaagaggagagcctggcaacattggattccctggacccaaaggcccc
actggtgatcctggcaaaaacggtgataaaggtcatgctggtcttgctggtgctcggggt
gctccaggtcctgatggaaacaatggtgctcagggacctcctggaccacagggtgttcaa
ggtggaaaaggtgaacagggtccccctggtcctccaggcttccagggtctgcctggcccc
tcaggtcccgctggtgaagttggcaaaccaggagaaaggggtctccatggtgagtttggt
ctccctggtcctgctggtccaagaggggaacgcggtcccccaggtgagagtggtgctgcc
ggtcctactggtcctattggaagccgaggtccttctggacccccagggcctgatggaaac
aagggtgaacctggtgtggttggtgctgtgggcactgctggtccatctggtcctagtgga
ctcccaggagagaggggtgctgctggcatacctggaggcaagggagaaaagggtgaacct
ggtctcagaggtgaaattggtaaccctggcagagatggtgctcgtggtgctcctggtgct
gtaggtgcccctggtcctgctggagccacaggtgaccggggcgaagctggggctgctggt
cctgctggtcctgctggtcctcggggaagccctggtgaacgtggtgaggtcggtcctgct
ggccccaatggatttgctggtcctgctggtgctgctggtcaacctggtgctaaaggagaa
agaggagccaaagggcctaagggtgaaaacggtgttgttggtcccacaggccccgttgga
gctgctggcccagctggtccaaatggtccccccggtcctgctggaagtcgtggtgatgga
ggcccccctggtatgactggtttccctggtgctgctggacggactggtcccccaggaccc
tctggtatttctggccctcctggtccccctggtcctgctgggaaagaagggcttcgtggt
cctcgtggtgaccaaggtccagttggccgaactggagaagtaggtgcagttggtccccct
ggcttcgctggtgagaagggtccctctggagaggctggtactgctggacctcctggcact
ccaggtcctcagggtcttcttggtgctcctggtattctgggtctccctggctcgagaggt
gaacgtggtctaccaggtgttgctggtgctgtgggtgaacctggtcctcttggcattgcc
ggccctcctggggcccgtggtcctcctggtgctgtgggtagtcctggagtcaacggtgct
cctggtgaagctggtcgtgatggcaaccctgggaacgatggtcccccaggtcgcgatggt
caacccggacacaagggagagcgcggttaccctggcaatattggtcccgttggtgctgca
ggtgcacctggtcctcatggccccgtgggtcctgctggcaaacatggaaaccgtggtgaa
actggtccttctggtcctgttggtcctgctggtgctgttggcccaagaggtcctagtggc
ccacaaggcattcgtggcgataagggagagcccggtgaaaaggggcccagaggtcttcct
ggcttaaagggacacaatggattgcaaggtctgcctggtatcgctggtcaccatggtgat
caaggtgctcctggctccgtgggtcctgctggtcctaggggccctgctggtccttctggc
cctgctggaaaagatggtcgcactggacatcctggtacagttggacctgctggcattcga
ggccctcagggtcaccaaggccctgctggcccccctggtccccctggccctcctggacct
ccaggtgtaagcggtggtggttatgactttggttacgatggagacttctacagggctgac
cagcctcgctcagcaccttctctcagacccaaggactatgaagttgatgctactctgaag
tctctcaacaaccagattgagacccttcttactcctgaaggctctagaaagaacccagct
cgcacatgccgtgacttgagactcagccacccagagtggagcagtggttactactggatt
gaccctaaccaaggatgcactatggatgctatcaaagtatactgtgatttctctactggc
gaaacctgtatccgggcccaacctgaaaacatcccagccaagaactggtataggagctcc
aaggacaagaaacacgtctggctaggagaaactatcaatgctggcagccagtttgaatat
aatgtagaaggagtgacttccaaggaaatggctacccaacttgccttcatgcgcctgctg
gccaactatgcctctcagaacatcacctaccactgcaagaacagcattgcatacatggat
gaggagactggcaacctgaaaaaggctgtcattctacagggctctaatgatgttgaactt
gttgctgagggcaacagcaggttcacttacactgttcttgtagatggctgctctaaaaag
acaaatgaatggggaaagacaatcattgaatacaaaacaaataagccatcacgcctgccc
ttccttgatattgcacctttggacatcggtggtgctgaccaggaattctttgtggacatt
ggcccagtctgtttcaaataa

DBGET integrated database retrieval system