KEGG   Homo sapiens (human): 1311Help
Entry
1311              CDS       T01001                                 

Gene name
COMP, EDM1, EPD1, MED, PSACH, THBS5
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Disease
H00476  
Multiple epiphyseal dysplasia (MED)
H00477  
Pseudoachondroplasia (PSACH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1311 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1311 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1311 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    1311 (COMP)
 Human Diseases
  Infectious diseases
   05144 Malaria
    1311 (COMP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1311 (COMP)
  Exosomal proteins of colorectal cancer cells
   1311 (COMP)
  Exosomal proteins of bladder cancer cells
   1311 (COMP)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1311 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 757 aa AA seqDB search
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacctgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagtacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggcttctgcttccccggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aacggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccaccagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagtgcggcccgtgccagcccggcttcgtgggcgaccaggcgtccggc
tgccagcggcgcgcacagcgcttctgccccgacggctcgcccagcgagtgccacgagcat
gcagactgcgtcctagagcgcgatggctcgcggtcgtgcgtgtgtgccgttggctgggcc
ggcaacgggatcctctgtggtcgcgacactgacctagacggcttcccggacgagaagctg
cgctgcccggagcgccagtgccgtaaggacaactgcgtgactgtgcccaactcagggcag
gaggatgtggaccgcgatggcatcggagacgcctgcgatccggatgccgacggggacggg
gtccccaatgaaaaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagagcaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgtgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagtgcccaggaggactcagac
cacgatggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgcggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcacgctcaccgacttcagggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgaccccaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcaaacg
tattggcaggcgaaccccttccgtgctgtggccgagcctggcatccaactcaaggctgtg
aagtcttccacaggccccggggaacagctgcggaacgctctgtggcatacaggagacaca
gagtcccaggtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaag
tcctatcgttggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctat
gagggccctgagctggtggccgacagcaacgtggtcttggacacaaccatgcggggtggc
cgcctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgc
tgcaatgacaccatcccagaggactatgagacccatcagctgcggcaagcctag

DBGET integrated database retrieval system