KEGG   Homo sapiens (human): 1410Help
Entry
1410              CDS       T01001                                 

Gene name
CRYAB, CMD1II, CRYA2, CTPP2, CTRCT16, HEL-S-101, HSPB5, MFM2
Definition
crystallin, alpha B
Orthology
K09542  
crystallin, alpha B
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H00594  
Distal muscular dystrophies
H00595  
Myofibrillar myopathies (MFM)
H01202  
Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1410 (CRYAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1410 (CRYAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q22.3-q23.1
AA seq 175 aa AA seqDB search
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccgccgccccttctttcctttccactccccc
agccgcctctttgaccagttcttcggagagcacctgttggagtctgatcttttcccgacg
tctacttccctgagtcccttctaccttcggccaccctccttcctgcgggcacccagctgg
tttgacactggactctcagagatgcgcctggagaaggacaggttctctgtcaacctggat
gtgaagcacttctccccagaggaactcaaagttaaggtgttgggagatgtgattgaggtg
catggaaaacatgaagagcgccaggatgaacatggtttcatctccagggagttccacagg
aaataccggatcccagctgatgtagaccctctcaccattacttcatccctgtcatctgat
ggggtcctcactgtgaatggaccaaggaaacaggtctctggccctgagcgcaccattccc
atcacccgtgaagagaagcctgctgtcaccgcagcccccaagaaatag

DBGET integrated database retrieval system