KEGG   Homo sapiens (human): 1436Help
Entry
1436              CDS       T01001                                 

Gene name
CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R
Definition
colony stimulating factor 1 receptor (EC:2.7.10.1)
Orthology
K05090  
macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
Pathways in cancer
Transcriptional misregulation in cancer
Disease
H00028  
Choriocarcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
5q32
AA seq 972 aa AA seqDB search
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttg
cgatgtgtgggcaatggcagcgtggaatgggatggccccccatcacctcactggaccctg
tactctgatggctccagcagcatcctcagcaccaacaacgctaccttccaaaacacgggg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctat
gtcaaagaccctgcccggccctggaacgtgctagcacaggaggtggtcgtgttcgaggac
caggacgcactactgccctgtctgctcacagacccggtgctggaagcaggcgtctcgctg
gtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcat
ggcttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcagcgttgatgttaactttgatgtcttcctccaacacaac
aacaccaagctcgcaatccctcaacaatctgactttcataataaccgttaccaaaaagtc
ctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctac
ttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcccaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagagctctgacgtttgagctcacccttcgatac
cccccagaggtaagcgtcatatggacattcatcaacggctctggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgatagg
tgtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccag
gagcccttccacaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaac
caaacctacgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccacacgcatcccccggatgagttcctcttcacaccagtggtggtc
gcctgcatgtccatcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacg
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaggaggccctcatgtccgagctgaagatcatgagccacctg
ggccagcacgagaacatcgtcaaccttctgggagcctgtacccatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccccggccaggaccccgagggaggcgtcgactataag
aacatccacctcgagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggca
gcgcgtaacgtgctgttgaccaatggtcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacattgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccaccttccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagag
cgggactataccaatctgccgagcagcagcagaagcggtggcagcggcagcagcagcagt
gagctggaggaggagagctctagtgagcacctgacctgctgcgagcaaggggatatcgcc
cagcccttgctgcagcccaacaactatcagttctgctga

DBGET integrated database retrieval system