KEGG   Homo sapiens (human): 144165Help
Entry
144165            CDS       T01001                                 

Gene name
PRICKLE1, EPM1B, RILP
Definition
prickle homolog 1 (Drosophila)
Orthology
K04511  
prickle
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Disease
H00810  
Progressive myoclonic epilepsy (PME)
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q12
AA seq 831 aa AA seqDB search
MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV
NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA
VMHAVCEQCGLKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG
RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC
GCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI
YCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKF
PGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLL
KFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGL
GDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSL
ALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSS
ELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEIRQPPMSERTRRRV
YNFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDRLRLYTPDNYEKFIQNKSARE
IQAYIQNADLYGQYAHATSDYGLQNPGMNRFLGLYGEDDDSWCSSSSSSSDSEEEGYFLG
QPIPQPRPQRFAYYTDDLSSPPSALPTPQFGQRTTKSKKKKGHKGKNCIIS
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggagatggagcccaagatgagcaaactggcctttggctgtcagagaagttcc
acatcagatgatgactctggctgtgcattggaggagtacgcctgggtccccccgggcctg
agaccagagcagatccagctctattttgcttgcttaccagaggaaaaagttccttacgtt
aacagccccggagagaagcatcggattaaacagcttttgtaccagttaccaccacatgat
aatgaggtacggtattgccagtctttgagtgaagaggagaaaaaagagttgcaggtgttc
agtgctcagcggaagaaagaagcactgggaagaggaacaattaagcttctgtccagagca
gtcatgcatgctgtgtgtgagcagtgtggtttgaagataaatggaggtgaagttgcagtg
ttcgcctcccgtgcgggccctggtgtgtgctggcacccatcctgttttgtctgtttcacg
tgtaatgagctgctggtcgacctcatctatttttatcaggatggaaaaattcactgtggc
aggcaccatgcagaactgctcaaaccacggtgctcagcatgtgacgagataatttttgct
gatgagtgcacagaagctgagggtcgccattggcacatgaaacacttctgctgccttgag
tgtgaaacggtcctgggaggacagaggtatatcatgaaggacggccgccccttctgctgt
ggctgttttgagtctctctatgcggagtactgtgaaacctgtggggaacatattggtgtg
gaccatgcacagatgacctatgacgggcagcactggcacgccacggaagcctgcttttct
tgtgcccagtgtaaagcctctttgttgggatgtcccttccttcccaaacagggtcagatt
tactgctcaaaaacgtgcagtcttggtgaagacgtccatgcctctgattcttccgactct
gcatttcagtcagctcgatcaagagactcccgaagaagtgtccgaatgggcaagagcagc
cggtcagcagatcagtgtagacagtctctcctcttatcgcctgctctgaactacaagttt
cctggcctctcaggcaatgctgatgacaccctttctcgaaaattggatgatctgagtctc
tccagacaaggaacaagttttgccagtgaagaattttggaaaggcagagtagagcaggaa
actccagaagaccctgaagaatgggctgatcatgaagattatatgacgcagctcctcctc
aagtttggtgataaaagcctctttcagccacagcccaatgagatggatattcgagccagt
gagcactggatatctgataacatggttaaaagtaagaccgagttaaagcaaaataaccag
agccttgcaagtaaaaaataccagtctgatatgtactgggcacagtcacaagatggactg
ggcgattctgcttatggcagccacccaggccctgcaagcagtagaaggcttcaggaattg
gaactggaccatggggcttcagggtataatcatgatgaaacacagtggtatgaagattcc
ctggagtgtctgtcagacctgaaaccagagcaaagtgttcgggattcgatggattctttg
gcattgtccaatatcacaggggcttcggtggatggagaaaacaagccaaggccatcattg
tattctctgcaaaattttgaggagatggaaacagaagattgtgagaagatgagcaatatg
ggaactttgaactcttccatgctgcacaggagtgcagagtccttaaagagtctaagttca
gagttgtgtccagagaaaatcctgcctgaagagaagccagtacatctgccagtgctcaga
aggtccaagtctcaatccagaccccagcaggtcaagttttctgatgatgtcattgacaat
gggaactatgacattgaaatccggcagcctccgatgagtgaaaggactcggagacgcgtc
tacaattttgaagagaggggatccaggtctcatcaccaccgccgccggagaagtagaaag
tcccgctccgacaatgccctgaatcttgttacagaaagaaaatactctcccaaggacaga
ctgcggctgtacacccccgataactatgagaaatttatacagaataaaagtgcccgggag
atccaagcatacatccagaatgctgatctctacggacagtacgcccatgccacttccgat
tatggcctgcagaacccaggaatgaatcggtttctgggactctacggcgaggatgatgat
tcctggtgttcttcctcctcctcctcttccgactcggaagaagaaggatattttcttgga
caaccaatccctcaaccccggccacagagatttgcctactatacagatgacctttctagt
ccaccatctgcacttcccacccctcagtttggtcagaggacaacaaaatccaagaagaaa
aagggacacaagggcaaaaattgtattatttcttaa

DBGET integrated database retrieval system