KEGG   Homo sapiens (human): 1471Help
Entry
1471              CDS       T01001                                 

Gene name
CST3, ARMD11
Definition
cystatin C
Orthology
K13899  
cystatin-C
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Disease
H00821  
Macular degeneration
H01185  
Cerebral amyloid angiopathy (CAA)
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
20p11.21
AA seq 146 aa AA seqDB search
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcccctgcgcgccccgctgctcctgctggccatcctggccgtggccctggcc
gtgagccccgcggccggctccagtcccggcaagccgccgcgcctggtgggaggccccatg
gacgccagcgtggaggaggagggtgtgcggcgtgcactggactttgccgtcggcgagtac
aacaaagccagcaacgacatgtaccacagccgcgcgctgcaggtggtgcgcgcccgcaag
cagatcgtagctggggtgaactacttcttggacgtggagctgggccgaaccacgtgtacc
aagacccagcccaacttggacaactgccccttccatgaccagccacatctgaaaaggaaa
gcattctgctctttccagatctacgctgtgccttggcagggcacaatgaccttgtcgaaa
tccacctgtcaggacgcctag

DBGET integrated database retrieval system