KEGG   Homo sapiens (human): 1499Help
Entry
1499              CDS       T01001                                 

Gene name
CTNNB1, CTNNB, EVR7, MRD19, armadillo
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04670  Leukocyte transendothelial migration
hsa04916  Melanogenesis
hsa04919  Thyroid hormone signaling pathway
hsa04934  Cushing's syndrome
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
Disease
H00018  Gastric cancer
H00020  Colorectal cancer
H00026  Endometrial cancer
H00032  Thyroid cancer
H00048  Hepatocellular carcinoma
H00773  Autosomal dominant mental retardation
H00947  Pilomatricoma
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1499 (CTNNB1)
   04310 Wnt signaling pathway
    1499 (CTNNB1)
   04390 Hippo signaling pathway
    1499 (CTNNB1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1499 (CTNNB1)
   04520 Adherens junction
    1499 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    1499 (CTNNB1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1499 (CTNNB1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    1499 (CTNNB1)
   04916 Melanogenesis
    1499 (CTNNB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1499 (CTNNB1)
   05205 Proteoglycans in cancer
    1499 (CTNNB1)
   05210 Colorectal cancer
    1499 (CTNNB1)
   05225 Hepatocellular carcinoma
    1499 (CTNNB1)
   05226 Gastric cancer
    1499 (CTNNB1)
   05216 Thyroid cancer
    1499 (CTNNB1)
   05217 Basal cell carcinoma
    1499 (CTNNB1)
   05215 Prostate cancer
    1499 (CTNNB1)
   05213 Endometrial cancer
    1499 (CTNNB1)
   05224 Breast cancer
    1499 (CTNNB1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1499 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1499 (CTNNB1)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1499 (CTNNB1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    1499 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    1499 (CTNNB1)
   05166 HTLV-I infection
    1499 (CTNNB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1499 (CTNNB1)
   05165 Human papillomavirus infection
    1499 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 1499
NCBI-ProteinID: NP_001091679
OMIM: 116806
HGNC: 2514
Ensembl: ENSG00000168036
Vega: OTTHUMG00000131393
Pharos: P35222(Tchem)
UniProt: P35222 A0A024R2Q3
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3p22.1
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttacgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
cccgcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system