KEGG   Homo sapiens (human): 1535Help
Entry
1535              CDS       T01001                                 

Gene name
CYBA, p22-PHOX
Definition
cytochrome b-245, alpha polypeptide
Orthology
K08009  
cytochrome b-245, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Leishmaniasis
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1535 (CYBA)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1535 (CYBA)
  Development
   04380 Osteoclast differentiation
    1535 (CYBA)
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    1535 (CYBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q24
AA seq 195 aa AA seqDB search
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc
tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag
aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc
gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc
gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc
tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg
ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system