KEGG   Homo sapiens (human): 1535Help
Entry
1535              CDS       T01001                                 

Gene name
CYBA, p22-PHOX
Definition
cytochrome b-245, alpha polypeptide
Orthology
K08009  
cytochrome b-245, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Leishmaniasis
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16q24
AA seq 195 aa AA seqDB search
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc
tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag
aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc
gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc
gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc
tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg
ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system