KEGG   Homo sapiens (human): 1535Help
Entry
1535              CDS       T01001                                 

Gene name
CYBA, p22-PHOX
Definition
(RefSeq) cytochrome b-245 alpha chain
  KO
K08009  
cytochrome b-245, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
NOD-like receptor signaling pathway
Leukocyte transendothelial migration
Leishmaniasis
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1535 (CYBA)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    1535 (CYBA)
   04670 Leukocyte transendothelial migration
    1535 (CYBA)
  Development
   04380 Osteoclast differentiation
    1535 (CYBA)
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    1535 (CYBA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    1535 (CYBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16q24
AA seq 195 aa AA seqDB search
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc
tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag
aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc
gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc
gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc
tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg
ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system