KEGG   Homo sapiens (human): 1536Help
Entry
1536              CDS       T01001                                 

Gene name
CYBB, AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX
Definition
cytochrome b-245, beta polypeptide
Orthology
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    1536 (CYBB)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1536 (CYBB)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1536 (CYBB)
  Development
   04380 Osteoclast differentiation
    1536 (CYBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp21.1
AA seq 570 aa AA seqDB search
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaggggctctccatttttgtcattctggtttggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgatattccacctaagttcttt
tacacaagaaaacttcttgggtcagcactggcactggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctcttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcactctgcgattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaataattctgatccttattcagtagca
ctctctgaacttggagacaggcaaaatgaaagttatctcaattttgctcgaaagagaata
aagaaccctgaaggaggcctgtacctggctgtgaccctgttggcaggcatcactggagtt
gtcatcacgctgtgcctcatattaattatcacttcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagaccgcagagagtttggctgtgcataat
ataacagtttgtgaacaaaaaatctcagaatggggaaaaataaaggaatgcccaatccct
cagtttgctggaaaccctcctatgacttggaaatggatagtgggtcccatgtttctgtat
ctctgtgagaggttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaa
gtgggacaatacatttttgtcaagtgcccaaaggtgtccaagctggagtggcaccctttt
acactgacatccgcccctgaggaagacttctttagtatccatatccgcatcgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtgg
aaactacctaagatagcggttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtacaaatattgcaataacgccaccaatctgaagctcaaaaagatctac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagatctgctgcaactg
ctggagagccagatgcaggaaaggaacaatgccggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataatgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctgagtaaacaaagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system