KEGG   Homo sapiens (human): 1536Help
Entry
1536              CDS       T01001                                 

Gene name
CYBB, AMCBX2, CGD, GP91-1, GP91-PHOX, GP91PHOX, IMD34, NOX2, p91-PHOX
Definition
(RefSeq) cytochrome b-245 beta chain
  KO
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
NOD-like receptor signaling pathway
Leukocyte transendothelial migration
AGE-RAGE signaling pathway in diabetic complications
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    1536 (CYBB)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1536 (CYBB)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    1536 (CYBB)
   04670 Leukocyte transendothelial migration
    1536 (CYBB)
  Development
   04380 Osteoclast differentiation
    1536 (CYBB)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1536 (CYBB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    1536 (CYBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp21.1
AA seq 570 aa AA seqDB search
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHL
FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHN
ITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaggggctctccatttttgtcattctggtttggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgatattccacctaagttcttt
tacacaagaaaacttcttgggtcagcactggcactggccagggcccctgcagcctgcctg
aatttcaactgcatgctgattctcttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcactctgcgattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaataattctgatccttattcagtagca
ctctctgaacttggagacaggcaaaatgaaagttatctcaattttgctcgaaagagaata
aagaaccctgaaggaggcctgtacctggctgtgaccctgttggcaggcatcactggagtt
gtcatcacgctgtgcctcatattaattatcacttcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagaccgcagagagtttggctgtgcataat
ataacagtttgtgaacaaaaaatctcagaatggggaaaaataaaggaatgcccaatccct
cagtttgctggaaaccctcctatgacttggaaatggatagtgggtcccatgtttctgtat
ctctgtgagaggttggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcaccctttcaaaaccatcgagctacagatgaagaagaaggggttcaaaatggaa
gtgggacaatacatttttgtcaagtgcccaaaggtgtccaagctggagtggcaccctttt
acactgacatccgcccctgaggaagacttctttagtatccatatccgcatcgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcgtgg
aaactacctaagatagcggttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtacaaatattgcaataacgccaccaatctgaagctcaaaaagatctac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagatctgctgcaactg
ctggagagccagatgcaggaaaggaacaatgccggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataatgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctctgtggacctgaa
gccttggctgaaaccctgagtaaacaaagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system