KEGG   Homo sapiens (human): 1540Help
Entry
1540              CDS       T01001                                 

Gene name
CYLD, BRSS, CDMT, CYLD1, CYLDI, EAC, MFT, MFT1, SBS, TEM, USPL2
Definition
(RefSeq) CYLD lysine 63 deubiquitinase
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Disease
H00827  
Brooke-Spiegler syndrome
H00828  
Familial cylindromatosis
H00829  
Multiple familial trichoepithelioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    1540 (CYLD)
  Development
   04380 Osteoclast differentiation
    1540 (CYLD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     1540 (CYLD)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C67
   1540 (CYLD)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    1540 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
16q12.1
AA seq 956 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagtcacttcaccctactgggaagagcggatt
ttttacttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgtagagataaatgaaaagttcacagagttactt
ttggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgtcctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacccctgttagcagagaggacagtctccgga
atattctttggagttgaattgctggaagaaggtcgtggtcaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagattgtggcgtgtttgttgcattggac
aagctagaactcatagaagatgatgacactgcattggaaagtgattacgcaggtcctggg
gacacaatgcaggtcgaacttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattt
gatggagtgcagctttgtagttttgcgtgtgttgaaagtacaattctattgcacatcaat
gatatcatcccagctttatcagagagtgtgacgcaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcatccagtcataataaaccaaaggctaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatggg
tcttctgttgactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagtt
gcagaagaccctgcaaaatctcttacagagatatctacagactttgaccgttcttcacca
ccactccagcctcctcctgtgaactcactgaccaccgagaacagattccactctttacca
ttcagtctcaccaagatgcccaataccaatggaagtattggccacagtccactttctctg
tcagcccagtctgtaatggaagagctaaacactgcacccgtccaagagagtccacccttg
gccatgcctcctgggaactcacatggtctagaagtgggctcattggctgaagttaaggag
aaccctcctttctatggggtaatccgttggatcggtcagccaccaggactgaatgaagtg
ctcgctggactggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggc
actcggtatttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcagg
cctgactctaggtttgcatcattgcagccggtttccaatcagattgagcgctgtaactct
ttagcatttggaggctacttaagtgaagtagtagaagaaaatactccaccaaaaatggaa
aaagaaggcttggagataatgattgggaagaagaaaggcatccagggtcattacaattct
tgttacttagactcaaccttattctgcttatttgcttttagttctgttctggacactgtg
ttacttagacccaaagaaaagaacgatgtagaatattatagtgaaacccaagagctactg
aggacagaaattgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatg
aaactgaggaaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaa
gatcctgaggaattcttgaatattctgtttcatcatattttaagggtagaacctttgcta
aaaataagatcagcaggtcaaaaggtacaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggcgttcccacaattcagcagttgttagaatggtcttttatcaac
agtaacctgaaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagactttaaactatttaaaaaaatttttccttctctggaattaaatataacagattta
cttgaagacactcccagacagtgccggatatgtggagggcttgcaatgtatgagtgtaga
gaatgctacgacgatccggacatctcagctggaaaaatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatccgaagaggctgaatcataaatataacccagtgtcactt
cccaaagacttacccgactgggactggagacacggctgcatcccttgccagaatatggag
ttatttgctgttctctgcatagaaacaagccactatgttgcttttgtgaagtatgggaag
gacgattctgcctggctcttctttgacagcatggccgatcgggatggtggtcagaatggc
ttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaagatgtctctg
gaagacctgcattccttggactccaggagaatccaaggctgtgcacgaagactgctttgt
gatgcatatatgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system