KEGG   Homo sapiens (human): 158Help
Entry
158               CDS       T01001                                 

Gene name
ADSL, AMPS, ASASE, ASL
Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Disease
H00197  
Adenylosuccinate lyase deficiency
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 484 aa AA seqDB search
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD
NDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
ELCL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggaggcgatcatggttcgcccgacagctaccgctcacctcttgcctcccgc
tatgccagcccggagatgtgcttcgtgtttagcgacaggtataaattccggacatggcgg
cagctgtggctgtggctggcggaggccgagcagacattgggtttgcctatcacagatgaa
caaatccaggagatgaaatcaaacctggagaacatcgacttcaagatggcagctgaggaa
gagaaacgtttacgacatgatgtgatggctcacgtgcacacatttggccactgctgtcca
aaagctgcaggcattattcaccttggtgctacttcttgctatgttggagacaatactgac
ttgattattcttagaaatgcacttgacctgcttttgccaaagcttgccagagtgatctct
cggcttgccgactttgctaaggaacgagccagtctacccacattaggtttcacacatttc
cagcctgcacagctgaccacagttgggaaacgttgctgtctttggattcaggatctttgc
atggatctccagaacttgaagcgtgtccgagatgacctgcgcttccggggagtaaagggt
accactggcactcaggccagtttcctgcagctctttgagggagatgaccataaggtagag
cagcttgacaagatggtgacagaaaaggcaggatttaagagagctttcatcatcacaggg
cagacatatacacgaaaagtggatattgaagtactgtctgtgctggctagcttgggggca
tcagtgcacaagatttgcaccgacatacgcctcctggcaaacctcaaggagatggaggaa
ccctttgaaaaacagcagattggctcaagtgcgatgccatataagcggaatcccatgcgt
tcagaacgttgctgcagtcttgcccgccacctgatgacccttgtcatggacccgctacag
acagcatctgtccagtggtttgaacgcacactggatgatagtgccaaccgacggatctgt
ttggccgaggcatttcttaccgcagatactatattgaatacgctgcagaacatttctgaa
ggattggtcgtgtaccccaaagtaattgaacggcgcattcggcaagagctgcctttcatg
gccacagagaacatcatcatggccatggtcaaagctggaggtagccgccaggattgccat
gagaaaatcagagtgctttctcagcaggcagcttctgtggttaagcaggaagggggtgac
aatgacctcatagagcgtatccaggttgatgcctacttcagtcccattcactcccagttg
gatcatttactggatccttcttctttcactggtcgtgcctcccagcaggtgcagagattc
ttagaagaggaggtgtatcccctgttaaaaccatatgaaagcgtgatgaaggtgaaagca
gaattatgtctgtag

DBGET integrated database retrieval system