KEGG   Homo sapiens (human): 1594Help
Entry
1594              CDS       T01001                                 

Gene name
CYP27B1, CP2B, CYP1, CYP1alpha, CYP27B, P450c1, PDDR, VDD1, VDDR, VDDRI, VDR
Definition
cytochrome P450, family 27, subfamily B, polypeptide 1 (EC:1.14.13.13)
Orthology
K07438  
25-hydroxyvitamin D3 1alpha-hydroxylase [EC:1.14.13.13]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Tuberculosis
Module
Cholecalciferol biosynthesis
Disease
H00408  
Type I diabetes mellitus
H01143  
Vitamin D-dependent rickets
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    1594 (CYP27B1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1594 (CYP27B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.13  calcidiol 1-monooxygenase
     1594 (CYP27B1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP27 family
   1594 (CYP27B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
12q14.1
AA seq 508 aa AA seqDB search
MTQTLKYASRVFHRVRWAPELGASLGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSR
LHELQVQGAAHFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCR
QRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPP
ALVRDVAGEFYKFGLEGIAAVLLGSRLGCLEAQVPPDTETFIRAVGSVFVSTLLTMAMPH
WLRHLVPGPWGRLCRDWDQMFAFAQRHVERREAEAAMRNGGQPEKDLESGAHLTHFLFRE
ELPAQSILGNVTELLLAGVDTVSNTLSWALYELSRHPEVQTALHSEITAALSPGSSAYPS
ATVLSQLPLLKAVVKEVLRLYPVVPGNSRVPDKDIHVGDYIIPKNTLVTLCHYATSRDPA
QFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELELQMALAQILTHFEVQP
EPGAAPVRPKTRTVLVPERSINLQFLDR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccctcaagtacgcctccagagtgttccatcgcgtccgctgggcgcccgag
ttgggcgcctccctaggctaccgagagtaccactcagcacgccggagcttggcagacatc
ccaggcccctctacgcccagctttctggccgaacttttctgcaagggggggctgtcgagg
ctacacgagctgcaggtgcagggcgccgcgcacttcgggccggtgtggctagccagcttt
gggacagtgcgcaccgtgtacgtggctgcccctgcactcgtcgaggagctgctgcgacag
gagggaccccggcccgagcgctgcagcttctcgccctggacggagcaccgccgctgccgc
cagcgggcttgcggactgctcactgcggaaggcgaagaatggcaaaggctccgcagtctc
ctggccccgctcctcctccggcctcaagcggccgcccgctacgccggaaccctgaacaac
gtagtctgcgaccttgtgcggcgtctgaggcgccagcggggacgtggcacggggccgccc
gccctggttcgggacgtggcgggggaattttacaagttcggactggaaggcatcgccgcg
gttctgctcggctcgcgcttgggctgcctggaggctcaagtgccacccgacacggagacc
ttcatccgcgctgtgggctcggtgtttgtgtccacgctgttgaccatggcgatgccccac
tggctgcgccaccttgtgcctgggccctggggccgcctctgccgagactgggaccagatg
tttgcatttgctcagaggcacgtggagcggcgagaggcagaggcagccatgaggaacgga
ggacagcccgagaaggacctggagtctggggcgcacctgacccacttcctgttccgggaa
gagttgcctgcccagtccatcctgggaaatgtgacagagttgctattggcgggagtggac
acggtgtccaacacgctctcttgggctctgtatgagctctcccggcaccccgaagtccag
acagcactccactcagagatcacagctgccctgagccctggctccagtgcctacccctca
gccactgttctgtcccagctgcccctgctgaaggcggtggtcaaggaagtgctaagactg
taccctgtggtacctggaaattctcgtgtcccagacaaagacattcatgtgggtgactat
attatccccaaaaatacgctggtcactctgtgtcactatgccacttcaagggaccctgcc
cagttcccagagccaaattcttttcgtccagctcgctggctgggggagggtcccaccccc
cacccatttgcatctcttccctttggctttggcaagcgcagctgtatggggagacgcctg
gcagagcttgaattgcaaatggctttggcccagatcctaacacattttgaggtgcagcct
gagccaggtgcggccccagttagacccaagacccggactgtcctggtacctgaaaggagc
atcaacctacagtttttggacagatag

DBGET integrated database retrieval system