KEGG   Homo sapiens (human): 161742Help
Entry
161742            CDS       T01001                                 

Gene name
SPRED1, NFLS, hSpred1, spred-1
Definition
sprouty-related, EVH1 domain containing 1
Orthology
K04703  
sprouty-related, EVH1 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Disease
H00523  
Noonan syndrome and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    161742 (SPRED1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     161742 (SPRED1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q14
AA seq 444 aa AA seqDB search
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFI
RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFED
LNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQ
DEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET
KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIK
RCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY
VPLRMCHRCGEACGCCGGKHKAAG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggagacggcgacttctgacaacgataatagttatgcacgagtgcgagctgtg
gtgatgacccgagatgactcaagtggtggatggttaccacttggagggagtggactaagc
agcgtcactgtcttcaaagtccctcatcaggaagagaatggctgtgctgacttttttatc
cgtggagagcgactcagggacaaaatggtggttttggaatgtatgcttaaaaaagacctc
atttataataaggtcactccaacatttcaccactggaagattgatgacaagaagtttggt
cttacgtttcaaagtcctgctgatgctagggcttttgatagaggtatccgaagagctata
gaggatatttctcaaggatgccccgaatcaaaaaatgaagctgaaggggcagatgactta
caagcaaatgaagaggattcttccagttctctagtgaaggatcacctttttcagcaagag
acagttgttaccagtgagccttatagaagctcaaatataagaccttctccctttgaagat
ctgaatgccagaagagtctacatgcaaagccaagccaatcagataacatttggtcagcca
ggcttggacattcagagcagaagtatggaatacgtacagcggcaaatatccaaggaatgt
ggaagcctaaagtcccaaaatagggtccctttgaaatcaatcagacatgtcagctttcaa
gatgaggatgagattgtcagaataaaccctcgagatatcttaatacgtcgctatgcagac
tacagacatcctgacatgtggaaaaatgacttggaaagagatgatgctgattccagtatt
cagttttctaaaccagacagtaaaaaatcagactatctgtactcttgtggggatgagact
aagttaagttcacccaaagactctgtggtatttaagacgcagccttcctcattaaaaatt
aagaagtcaaaacgaagaaaagaggatggtgaacgttctcgctgcgtatactgccaggaa
aggtttaatcatgaagaaaatgttaggggaaaatgtcaggatgctccagaccctattaaa
agatgcatatatcaagttagttgcatgctctgtgcagagagcatgttgtatcattgtatg
tcagactcagagggagatttttctgatccctgttcgtgtgacactagcgacgacaagttc
tgcttgcgatggttagccctggtagctttgtctttcattgtaccatgtatgtgctgctac
gtccctttgagaatgtgccatcgctgtggtgaggcatgtggttgctgtggtgggaaacat
aaagctgctggatga

DBGET integrated database retrieval system