KEGG   Homo sapiens (human): 1639Help
Entry
1639              CDS       T01001                                 

Gene name
DCTN1, DAP-150, DP-150, P135
Definition
dynactin 1
Orthology
K04648  
dynactin 1
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Huntington's disease
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00856  
Distal hereditary motor neuropathies (dHMN)
H00879  
Perry syndrome
Class
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p13
AA seq 1253 aa AA seqDB search
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GTDTTAKTSKLPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPV
LTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQE
WKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAES
LQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDL
SSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMV
EMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQ
KRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFA
ETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAE
LIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVD
VYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPE
DCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKK
IRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEG
LLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSK
PPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKL
DSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQ
SKRTIEGLRGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHIS
QLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTH
THVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFAT
FPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggcacagagcaagaggcacgtgtacagccggacgcccagcggcagcaggatgagtgcg
gaggcaagcgcccggcctctgcgggtgggctcccgtgtagaggtgattggaaaaggccac
cgaggcactgtggcctatgttggagccacactgtttgccactggcaaatgggtaggcgtg
attctggatgaagcaaagggcaaaaatgatggaactgttcaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaggtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcttcaaaagtcctcaaaagagag
ggaactgatacaactgcaaagactagcaaactgcccacgcgcccagccagtactggggtg
gctggggccagtagctccctgggcccctctggctcagcgtcagcaggtgagctgagcagc
agtgagcccagcaccccggctcagactccgctggcagcacccatcatccccacgccggtc
ctcacctctcctggagcagtccccccgcttccttccccatccaaggaggaggagggacta
agggctcaggtgcgggacctggaggagaaactagagaccctgagactgaaacgggcagaa
gacaaagcaaagctaaaagagctggagaaacacaaaatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggccgacctgcagcggcgcctcaaggaggcgaga
aaggaagccaaggaggcgctggaggcaaaggaacgctatatggaggagatggctgatact
gctgatgccattgagatggccactttggacaaggagatggctgaagagcgggctgagtcc
ctgcagcaggaggtggaggcactgaaggagcgggtggacgagctcactactgacttagag
atcctcaaggctgagattgaagagaagggctcagatggcgctgcatccagttatcagctc
aagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgggatctt
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaa
gagctggaagttgtgaggcaacagcgggagcgtctgcaggaggagctaagccaggcagag
agcaccattgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatggtg
gagatgctgacagatcggaacctgaatctggaagagaaagtgcgcgagttgagggagact
gtgggagacttggaagcgatgaatgagatgaacgatgagctgcaggagaatgcacgtgag
acagaactggagctgcgggagcagctggacatggcaggcgcgcgggttcgtgaggcccag
aagcgtgtggaggcagcccaggagacggttgcagactaccagcagaccatcaagaagtac
cgccagctgaccgcccatctacaggatgtgaatcgggaactgacaaaccagcaggaagca
tctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgct
gagactaaggcccatgccaaggcaattgagatggaattgaggcagatggaggtggcccag
gccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcggccaggt
ggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggcagag
ctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcggcct
gggctgcgaggagctgctggggagcaactcagctttgctgctggactggtgtactcgctg
agcctgctgcaggccacgctacaccgctatgagcatgccctctctcagtgcagtgtggat
gtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagcgctccttggat
ttcctcattgaactgctgcacaaggatcagctggatgagactgtcaatgtggagcctctc
accaaggccatcaagtactatcagcatctgtacagcatccaccttgccgaacagcctgag
gactgtactatgcagctggctgaccacattaagttcacgcagagtgctctggactgcatg
agtgtggaggtaggacggctgcgtgccttcttgcagggtgggcaggaggctacagatatt
gccctcctgctccgggatctggaaacttcatgcagtgacatccgccagttctgcaagaag
atccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggcctttgga
ccacaggtatctgacacgctcctagactgcaggaaacacttgacgtgggtcgtggctgtg
ctgcaggaggtggcagctgctgctgcccagctcattgccccactggcagagaatgagggg
ctacttgtggctgctctggaggaactggctttcaaagcaagcgagcagatctatgggacc
ccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtaccatg
aacaagctggccacagccatgcaggagggggagtatgatgcagagcggccccccagcaag
cctccaccggttgaactgcgggctgctgcccttcgtgcagagatcacagatgctgaaggc
ctgggtttgaagctcgaagatcgagagacagttattaaggagttgaagaagtcactcaag
attaagggagaggagctaagtgaggccaatgtgcggctgagcctcctggagaagaagttg
gacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggaggag
acccaggcactgctgcgaaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatcgaccagctggaggcagagaaggcagaactaaagcagcgtctgaacagccag
tccaaacgcacgattgagggactccggggccctcctccttcaggcattgctactctggtc
tctggcattgctggtggagccatccctgggcaggctccagggtctgtgccaggcccaggg
ctggtgaaggactcaccactgctgcttcagcagatctctgccatgaggctgcacatctcc
cagctccagcatgagaacagcatcctcaagggagcccagatgaaggcatccttggcatcc
ctgccccctctgcatgttgcaaagctatcccatgagggccctggcagtgagttaccagct
ggagcgctgtatcgtaagaccagccagctgctggagacattgaatcaattgagcacacac
acgcacgtagtagacatcactcgcaccagccctgctgccaagagcccgtcggcccaactt
atggagcaagtggctcagcttaagtccctgagtgacaccgtcgagaagctcaaggatgag
gtcctcaaggagacagtatctcagcgccctggagccacagtacccactgactttgccacc
ttcccttcatcagccttcctcagggccaaggaggagcagcaggatgacacagtctacatg
ggcaaagtgaccttctcatgtgcggctggttttggacagcgacaccggctggtgctgacc
caggagcagctgcaccagcttcacagtcgcctcatctcctaa

DBGET integrated database retrieval system