KEGG   Homo sapiens (human): 1639Help
Entry
1639              CDS       T01001                                 

Gene name
DCTN1, DAP-150, DP-150, P135
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  
dynactin 1
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Huntington's disease
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00856  
Distal hereditary motor neuropathies (dHMN)
H00879  
Perry syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    1639 (DCTN1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1639 (DCTN1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    1639 (DCTN1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Dynactin complex
     1639 (DCTN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     1639 (DCTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p13
AA seq 1278 aa AA seqDB search
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGS
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPG
SELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE
KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRH
RLVLTQEQLHQLHSRLIS
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atggcacagagcaagaggcacgtgtacagccggacgcccagcggcagcaggatgagtgcg
gaggcaagcgcccggcctctgcgggtgggctcccgtgtagaggtgattggaaaaggccac
cgaggcactgtggcctatgttggagccacactgtttgccactggcaaatgggtaggcgtg
attctggatgaagcaaagggcaaaaatgatggaactgttcaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaggtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcttcaaaagtcctcaaaagagag
ggaactgatacaactgcaaagactagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcggcgacccaagcccacgcgcccagccagtactggggtg
gctggggccagtagctccctgggcccctctggctcagcgtcagcaggtgagctgagcagc
agtgagcccagcaccccggctcagactccgctggcagcacccatcatccccacgccggtc
ctcacctctcctggagcagtccccccgcttccttccccatccaaggaggaggagggacta
agggctcaggtgcgggacctggaggagaaactagagaccctgagactgaaacgggcagaa
gacaaagcaaagctaaaagagctggagaaacacaaaatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggccgacctgcagcggcgcctcaaggaggcgaga
aaggaagccaaggaggcgctggaggcaaaggaacgctatatggaggagatggctgatact
gctgatgccattgagatggccactttggacaaggagatggctgaagagcgggctgagtcc
ctgcagcaggaggtggaggcactgaaggagcgggtggacgagctcactactgacttagag
atcctcaaggctgagattgaagagaagggctcagatggcgctgcatccagttatcagctc
aagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgggatctt
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaa
gagctggaagttgtgaggcaacagcgggagcgtctgcaggaggagctaagccaggcagag
agcaccattgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatggtg
gagatgctgacagatcggaacctgaatctggaagagaaagtgcgcgagttgagggagact
gtgggagacttggaagcgatgaatgagatgaacgatgagctgcaggagaatgcacgtgag
acagaactggagctgcgggagcagctggacatggcaggcgcgcgggttcgtgaggcccag
aagcgtgtggaggcagcccaggagacggttgcagactaccagcagaccatcaagaagtac
cgccagctgaccgcccatctacaggatgtgaatcgggaactgacaaaccagcaggaagca
tctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgct
gagactaaggcccatgccaaggcaattgagatggaattgaggcagatggaggtggcccag
gccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcggccaggt
ggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggcagag
ctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcggcct
gggctgcgaggagctgctggggagcaactcagctttgctgctggactggtgtactcgctg
agcctgctgcaggccacgctacaccgctatgagcatgccctctctcagtgcagtgtggat
gtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagcgctccttggat
ttcctcattgaactgctgcacaaggatcagctggatgagactgtcaatgtggagcctctc
accaaggccatcaagtactatcagcatctgtacagcatccaccttgccgaacagcctgag
gactgtactatgcagctggctgaccacattaagttcacgcagagtgctctggactgcatg
agtgtggaggtaggacggctgcgtgccttcttgcagggtgggcaggaggctacagatatt
gccctcctgctccgggatctggaaacttcatgcagtgacatccgccagttctgcaagaag
atccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggcctttgga
ccacaggtatctgacacgctcctagactgcaggaaacacttgacgtgggtcgtggctgtg
ctgcaggaggtggcagctgctgctgcccagctcattgccccactggcagagaatgagggg
ctacttgtggctgctctggaggaactggctttcaaagcaagcgagcagatctatgggacc
ccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtaccatg
aacaagctggccacagccatgcaggagggggagtatgatgcagagcggccccccagcaag
cctccaccggttgaactgcgggctgctgcccttcgtgcagagatcacagatgctgaaggc
ctgggtttgaagctcgaagatcgagagacagttattaaggagttgaagaagtcactcaag
attaagggagaggagctaagtgaggccaatgtgcggctgagcctcctggagaagaagttg
gacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggaggag
acccaggcactgctgcgaaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatcgaccagctggaggcagagaaggcagaactaaagcagcgtctgaacagccag
tccaaacgcacgattgagggactccggggccctcctccttcaggcattgctactctggtc
tctggcattgctggtgaagaacagcagcgaggagccatccctgggcaggctccagggtct
gtgccaggcccagggctggtgaaggactcaccactgctgcttcagcagatctctgccatg
aggctgcacatctcccagctccagcatgagaacagcatcctcaagggagcccagatgaag
gcatccttggcatccctgccccctctgcatgttgcaaagctatcccatgagggccctggc
agtgagttaccagctggagcgctgtatcgtaagaccagccagctgctggagacattgaat
caattgagcacacacacgcacgtagtagacatcactcgcaccagccctgctgccaagagc
ccgtcggcccaacttatggagcaagtggctcagcttaagtccctgagtgacaccgtcgag
aagctcaaggatgaggtcctcaaggagacagtatctcagcgccctggagccacagtaccc
actgactttgccaccttcccttcatcagccttcctcagggccaaggaggagcagcaggat
gacacagtctacatgggcaaagtgaccttctcatgtgcggctggttttggacagcgacac
cggctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatctcctaa

DBGET integrated database retrieval system