KEGG   Homo sapiens (human): 1756Help
Entry
1756              CDS       T01001                                 

Gene name
DMD, BMD, CMD3B, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85
Definition
dystrophin
Orthology
K10366  
dystrophin
Organism
hsa  Homo sapiens (human)
Pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00294  
Dilated cardiomyopathy (DCM)
H00552  
Glycerol kinase deficiency (GKD)
H00562  
Dystrophinopathies
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    1756 (DMD)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1756 (DMD)
   05414 Dilated cardiomyopathy (DCM)
    1756 (DMD)
   05416 Viral myocarditis
    1756 (DMD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp21.2
AA seq 3677 aa AA seqDB search
MEDEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGS
TRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIM
AGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVC
QQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQVSIEAI
QEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVT
TSDPTRSPFPSQHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQAQGEI
SNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQMNLLN
SRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLEDLKR
QVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTE
DRWVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLKA
DLEKKKQSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTAQISQA
VTTTQPSLTQTTVMETVTTVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDI
TELHSWITRSEAVLQSPEFAIFRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQALV
EQMVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTT
AENWLKIQPTTPSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQGPMFLD
ADFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSETKLSIPQLS
VTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQSEFEEIEGR
WKKLSSQLVEHCQKLEEQMNKLRKIQNHIQTLKKWMAEVDVFLKEEWPALGDSEILKKQL
KQCRLLVSDIQTIQPSLNSVNEGGQKIKNEAEPEFASRLETELKELNTQWDHMCQQVYAR
KEALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQKAVEEMKRAKEEAQ
QKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACW
HELLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMRHSEDNPNQIRILAQ
TLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTF
IDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKEAAQRVLSQIDVAQ
KKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNL
YKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEK
CLKLSRKMRKEMNVLTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHL
KSITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNV
DHITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRGDH
CRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLK
EEDFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQR
RKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNA
VRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMTED
MPLEISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIKDSLQQS
SGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRR
FHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRTLNATGEE
IIQQSSKTDASILQEKLGSLNLRWQEVCKQLSDRKKRLEEQKNILSEFQRDLNEFVLWLE
EADNIASIPLEPGKEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQ
DKLENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLLLWLSPIR
NQLEIYNQPNQEGPFDVQETEIAVQAKQPDVEEILSKGQHLYKEKPATQPVKRKLEDLSS
EWKAVNRLLQELRAKQPDLAPGLTTIGASPTQTVTLVTQPVVTKETAISKLEMPSSLMLE
VPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLE
ELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEA
KEEAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLL
RDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEA
ETTANVLQDATRKERLLEDSKGVKELMKQWQDLQGEIEAHTDVYHNLDENSQKILRSLEG
SDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDEL
SRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEP
RELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDL
KLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQ
LSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPN
KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSA
ACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDT
GRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGED
VRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL
SHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQP
RSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPT
SPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNG
TTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFP
SSRGRNTPGKPMREDTM
NT seq 11034 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgaaagagaagatgttcaaaagaaaacattcacaaaatgggtaaatgcacaa
ttttctaagtttgggaagcagcatattgagaacctcttcagtgacctacaggatgggagg
cgcctcctagacctcctcgaaggcctgacagggcaaaaactgccaaaagaaaaaggatcc
acaagagttcatgccctgaacaatgtcaacaaggcactgcgggttttgcagaacaataat
gttgatttagtgaatattggaagtactgacatcgtagatggaaatcataaactgactctt
ggtttgatttggaatataatcctccactggcaggtcaaaaatgtaatgaaaaatatcatg
gctggattgcaacaaaccaacagtgaaaagattctcctgagctgggtccgacaatcaact
cgtaattatccacaggttaatgtaatcaacttcaccaccagctggtctgatggcctggct
ttgaatgctctcatccatagtcataggccagacctatttgactggaatagtgtggtttgc
cagcagtcagccacacaacgactggaacatgcattcaacatcgccagatatcaattaggc
atagagaaactactcgatcctgaagatgttgataccacctatccagataagaagtccatc
ttaatgtacatcacatcactcttccaagttttgcctcaacaagtgagcattgaagccatc
caggaagtggaaatgttgccaaggccacctaaagtgactaaagaagaacattttcagtta
catcatcaaatgcactattctcaacagatcacggtcagtctagcacagggatatgagaga
acttcttcccctaagcctcgattcaagagctatgcctacacacaggctgcttatgtcacc
acctctgaccctacacggagcccatttccttcacagcatttggaagctcctgaagacaag
tcatttggcagttcattgatggagagtgaagtaaacctggaccgttatcaaacagcttta
gaagaagtattatcgtggcttctttctgctgaggacacattgcaagcacaaggagagatt
tctaatgatgtggaagtggtgaaagaccagtttcatactcatgaggggtacatgatggat
ttgacagcccatcagggccgggttggtaatattctacaattgggaagtaagctgattgga
acaggaaaattatcagaagatgaagaaactgaagtacaagagcagatgaatctcctaaat
tcaagatgggaatgcctcagggtagctagcatggaaaaacaaagcaatttacatagagtt
ttaatggatctccagaatcagaaactgaaagagttgaatgactggctaacaaaaacagaa
gaaagaacaaggaaaatggaggaagagcctcttggacctgatcttgaagacctaaaacgc
caagtacaacaacataaggtgcttcaagaagatctagaacaagaacaagtcagggtcaat
tctctcactcacatggtggtggtagttgatgaatctagtggagatcacgcaactgctgct
ttggaagaacaacttaaggtattgggagatcgatgggcaaacatctgtagatggacagaa
gaccgctgggttcttttacaagacatccttctcaaatggcaacgtcttactgaagaacag
tgcctttttagtgcatggctttcagaaaaagaagatgcagtgaacaagattcacacaact
ggctttaaagatcaaaatgaaatgttatcaagtcttcaaaaactggccgttttaaaagcg
gatctagaaaagaaaaagcaatccatgggcaaactgtattcactcaaacaagatcttctt
tcaacactgaagaataagtcagtgacccagaagacggaagcatggctggataactttgcc
cggtgttgggataatttagtccaaaaacttgaaaagagtacagcacagatttcacaggct
gtcaccaccactcagccatcactaacacagacaactgtaatggaaacagtaactacggtg
accacaagggaacagatcctggtaaagcatgctcaagaggaacttccaccaccacctccc
caaaagaagaggcagattactgtggattctgaaattaggaaaaggttggatgttgatata
actgaacttcacagctggattactcgctcagaagctgtgttgcagagtcctgaatttgca
atctttcggaaggaaggcaacttctcagacttaaaagaaaaagtcaatgccatagagcga
gaaaaagctgagaagttcagaaaactgcaagatgccagcagatcagctcaggccctggtg
gaacagatggtgaatgagggtgttaatgcagatagcatcaaacaagcctcagaacaactg
aacagccggtggatcgaattctgccagttgctaagtgagagacttaactggctggagtat
cagaacaacatcatcgctttctataatcagctacaacaattggagcagatgacaactact
gctgaaaactggttgaaaatccaacccaccaccccatcagagccaacagcaattaaaagt
cagttaaaaatttgtaaggatgaagtcaaccggctatcaggtcttcaacctcaaattgaa
cgattaaaaattcaaagcatagccctgaaagagaaaggacaaggacccatgttcctggat
gcagactttgtggcctttacaaatcattttaagcaagtcttttctgatgtgcaggccaga
gagaaagagctacagacaatttttgacactttgccaccaatgcgctatcaggagaccatg
agtgccatcaggacatgggtccagcagtcagaaaccaaactctccatacctcaacttagt
gtcaccgactatgaaatcatggagcagagactcggggaattgcaggctttacaaagttct
ctgcaagagcaacaaagtggcctatactatctcagcaccactgtgaaagagatgtcgaag
aaagcgccctctgaaattagccggaaatatcaatcagaatttgaagaaattgagggacgc
tggaagaagctctcctcccagctggttgagcattgtcaaaagctagaggagcaaatgaat
aaactccgaaaaattcagaatcacatacaaaccctgaagaaatggatggctgaagttgat
gtttttctgaaggaggaatggcctgcccttggggattcagaaattctaaaaaagcagctg
aaacagtgcagacttttagtcagtgatattcagacaattcagcccagtctaaacagtgtc
aatgaaggtgggcagaagataaagaatgaagcagagccagagtttgcttcgagacttgag
acagaactcaaagaacttaacactcagtgggatcacatgtgccaacaggtctatgccaga
aaggaggccttgaagggaggtttggagaaaactgtaagcctccagaaagatctatcagag
atgcacgaatggatgacacaagctgaagaagagtatcttgagagagattttgaatataaa
actccagatgaattacagaaagcagttgaagagatgaagagagctaaagaagaggcccaa
caaaaagaagcgaaagtgaaactccttactgagtctgtaaatagtgtcatagctcaagct
ccacctgtagcacaagaggccttaaaaaaggaacttgaaactctaaccaccaactaccag
tggctctgcactaggctgaatgggaaatgcaagactttggaagaagtttgggcatgttgg
catgagttattgtcatacttggagaaagcaaacaagtggctaaatgaagtagaatttaaa
cttaaaaccactgaaaacattcctggcggagctgaggaaatctctgaggtgctagattca
cttgaaaatttgatgcgacattcagaggataacccaaatcagattcgcatattggcacag
accctaacagatggcggagtcatggatgagctaatcaatgaggaacttgagacatttaat
tctcgttggagggaactacatgaagaggctgtaaggaggcaaaagttgcttgaacagagc
atccagtctgcccaggagactgaaaaatccttacacttaatccaggagtccctcacattc
attgacaagcagttggcagcttatattgcagacaaggtggacgcagctcaaatgcctcag
gaagcccagaaaatccaatctgatttgacaagtcatgagatcagtttagaagaaatgaag
aaacataatcaggggaaggaggctgcccaaagagtcctgtctcagattgatgttgcacag
aaaaaattacaagatgtctccatgaagtttcgattattccagaaaccagccaattttgag
cagcgtctacaagaaagtaagatgattttagatgaagtgaagatgcacttgcctgcattg
gaaacaaagagtgtggaacaggaagtagtacagtcacagctaaatcattgtgtgaacttg
tataaaagtctgagtgaagtgaagtctgaagtggaaatggtgataaagactggacgtcag
attgtacagaaaaagcagacggaaaatcccaaagaacttgatgaaagagtaacagctttg
aaattgcattataatgagctgggagcaaaggtaacagaaagaaagcaacagttggagaaa
tgcttgaaattgtcccgtaagatgcgaaaggaaatgaatgtcttgacagaatggctggca
gctacagatatggaattgacaaagagatcagcagttgaaggaatgcctagtaatttggat
tctgaagttgcctggggaaaggctactcaaaaagagattgagaaacagaaggtgcacctg
aagagtatcacagaggtaggagaggccttgaaaacagttttgggcaagaaggagacgttg
gtggaagataaactcagtcttctgaatagtaactggatagctgtcacctcccgagcagaa
gagtggttaaatcttttgttggaataccagaaacacatggaaacttttgaccagaatgtg
gaccacatcacaaagtggatcattcaggctgacacacttttggatgaatcagagaaaaag
aaaccccagcaaaaagaagacgtgcttaagcgtttaaaggcagaactgaatgacatacgc
ccaaaggtggactctacacgtgaccaagcagcaaacttgatggcaaaccgcggtgaccac
tgcaggaaattagtagagccccaaatctcagagctcaaccatcgatttgcagccatttca
cacagaattaagactggaaaggcctccattcctttgaaggaattggagcagtttaactca
gatatacaaaaattgcttgaaccactggaggctgaaattcagcagggggtgaatctgaaa
gaggaagacttcaataaagatatgaatgaagacaatgagggtactgtaaaagaattgttg
caaagaggagacaacttacaacaaagaatcacagatgagagaaagcgagaggaaataaag
ataaaacagcagctgttacagacaaaacataatgctctcaaggatttgaggtctcaaaga
agaaaaaaggctctagaaatttctcatcagtggtatcagtacaagaggcaggctgatgat
ctcctgaaatgcttggatgacattgaaaaaaaattagccagcctacctgagcccagagat
gaaaggaaaataaaggaaattgatcgggaattgcagaagaagaaagaggagctgaatgca
gtgcgtaggcaagctgagggcttgtctgaggatggggccgcaatggcagtggagccaact
cagatccagctcagcaagcgctggcgggaaattgagagcaaatttgctcagtttcgaaga
ctcaactttgcacaaattcacactgtccgtgaagaaacgatgatggtgatgactgaagac
atgcctttggaaatttcttatgtgccttctacttatttgactgaaatcactcatgtctca
caagccctattagaagtggaacaacttctcaatgctcctgacctctgtgctaaggacttt
gaagatctctttaagcaagaggagtctctgaagaatataaaagatagtctacaacaaagc
tcaggtcggattgacattattcatagcaagaagacagcagcattgcaaagtgcaacgcct
gtggaaagggtgaagctacaggaagctctctcccagcttgatttccaatgggaaaaagtt
aacaaaatgtacaaggaccgacaagggcgatttgacagatctgttgagaaatggcggcgt
tttcattatgatataaagatatttaatcagtggctaacagaagctgaacagtttctcaga
aagacacaaattcctgagaattgggaacatgctaaatacaaatggtatcttaaggaactc
caggatggcattgggcagcggcaaactgttgtcagaacattgaatgcaactggggaagaa
ataattcagcaatcctcaaaaacagatgccagtattctacaggaaaaattgggaagcctg
aatctgcggtggcaggaggtctgcaaacagctgtcagacagaaaaaagaggctagaagaa
caaaagaatatcttgtcagaatttcaaagagatttaaatgaatttgttttatggttggag
gaagcagataacattgctagtatcccacttgaacctggaaaagagcagcaactaaaagaa
aagcttgagcaagtcaagttactggtggaagagttgcccctgcgccagggaattctcaaa
caattaaatgaaactggaggacccgtgcttgtaagtgctcccataagcccagaagagcaa
gataaacttgaaaataagctcaagcagacaaatctccagtggataaaggtttccagagct
ttacctgagaaacaaggagaaattgaagctcaaataaaagaccttgggcagcttgaaaaa
aagcttgaagaccttgaagagcagttaaatcatctgctgctgtggttatctcctattagg
aatcagttggaaatttataaccaaccaaaccaagaaggaccatttgacgttcaggaaact
gaaatagcagttcaagctaaacaaccggatgtggaagagattttgtctaaagggcagcat
ttgtacaaggaaaaaccagccactcagccagtgaagaggaagttagaagatctgagctct
gagtggaaggcggtaaaccgtttacttcaagagctgagggcaaagcagcctgacctagct
cctggactgaccactattggagcctctcctactcagactgttactctggtgacacaacct
gtggttactaaggaaactgccatctccaaactagaaatgccatcttccttgatgttggag
gtacctgctctggcagatttcaaccgggcttggacagaacttaccgactggctttctctg
cttgatcaagttataaaatcacagagggtgatggtgggtgaccttgaggatatcaacgag
atgatcatcaagcagaaggcaacaatgcaggatttggaacagaggcgtccccagttggaa
gaactcattaccgctgcccaaaatttgaaaaacaagaccagcaatcaagaggctagaaca
atcattacggatcgaattgaaagaattcagaatcagtgggatgaagtacaagaacacctt
cagaaccggaggcaacagttgaatgaaatgttaaaggattcaacacaatggctggaagct
aaggaagaagctgagcaggtcttaggacaggccagagccaagcttgagtcatggaaggag
ggtccctatacagtagatgcaatccaaaagaaaatcacagaaaccaagcagttggccaaa
gacctccgccagtggcagacaaatgtagatgtggcaaatgacttggccctgaaacttctc
cgggattattctgcagatgataccagaaaagtccacatgataacagagaatatcaatgcc
tcttggagaagcattcataaaagggtgagtgagcgagaggctgctttggaagaaactcat
agattactgcaacagttccccctggacctggaaaagtttcttgcctggcttacagaagct
gaaacaactgccaatgtcctacaggatgctacccgtaaggaaaggctcctagaagactcc
aagggagtaaaagagctgatgaaacaatggcaagacctccaaggtgaaattgaagctcac
acagatgtttatcacaacctggatgaaaacagccaaaaaatcctgagatccctggaaggt
tccgatgatgcagtcctgttacaaagacgtttggataacatgaacttcaagtggagtgaa
cttcggaaaaagtctctcaacattaggtcccatttggaagccagttctgaccagtggaag
cgtctgcacctttctctgcaggaacttctggtgtggctacagctgaaagatgatgaatta
agccggcaggcacctattggaggcgactttccagcagttcagaagcagaacgatgtacat
agggccttcaagagggaattgaaaactaaagaacctgtaatcatgagtactcttgagact
gtacgaatatttctgacagagcagcctttggaaggactagagaaactctaccaggagccc
agagagctgcctcctgaggagagagcccagaatgtcactcggcttctacgaaagcaggct
gaggaggtcaatactgagtgggaaaaattgaacctgcactccgctgactggcagagaaaa
atagatgagacccttgaaagactccaggaacttcaagaggccacggatgagctggacctc
aagctgcgccaagctgaggtgatcaagggatcctggcagcccgtgggcgatctcctcatt
gactctctccaagatcacctcgagaaagtcaaggcacttcgaggagaaattgcgcctctg
aaagagaacgtgagccacgtcaatgaccttgctcgccagcttaccactttgggcattcag
ctctcaccgtataacctcagcactctggaagacctgaacaccagatggaagcttctgcag
gtggccgtcgaggaccgagtcaggcagctgcatgaagcccacagggactttggtccagca
tctcagcactttctttccacgtctgtccagggtccctgggagagagccatctcgccaaac
aaagtgccctactatatcaaccacgagactcaaacaacttgctgggaccatcccaaaatg
acagagctctaccagtctttagctgacctgaataatgtcagattctcagcttataggact
gccatgaaactccgaagactgcagaaggccctttgcttggatctcttgagcctgtcagct
gcatgtgatgccttggaccagcacaacctcaagcaaaatgaccagcccatggatatcctg
cagattattaattgtttgaccactatttatgaccgcctggagcaagagcacaacaatttg
gtcaacgtccctctctgcgtggatatgtgtctgaactggctgctgaatgtttatgatacg
ggacgaacagggaggatccgtgtcctgtcttttaaaactggcatcatttccctgtgtaaa
gcacatttggaagacaagtacagataccttttcaagcaagtggcaagttcaacaggattt
tgtgaccagcgcaggctgggcctccttctgcatgattctatccaaattccaagacagttg
ggtgaagttgcatcctttgggggcagtaacattgagccaagtgtccggagctgcttccaa
tttgctaataataagccagagatcgaagcggccctcttcctagactggatgagactggaa
ccccagtccatggtgtggctgcccgtcctgcacagagtggctgctgcagaaactgccaag
catcaggccaaatgtaacatctgcaaagagtgtccaatcattggattcaggtacaggagt
ctaaagcactttaattatgacatctgccaaagctgctttttttctggtcgagttgcaaaa
ggccataaaatgcactatcccatggtggaatattgcactccgactacatcaggagaagat
gttcgagactttgccaaggtactaaaaaacaaatttcgaaccaaaaggtattttgcgaag
catccccgaatgggctacctgccagtgcagactgtcttagagggggacaacatggaaact
cccgttactctgatcaacttctggccagtagattctgcgcctgcctcgtcccctcagctt
tcacacgatgatactcattcacgcattgaacattatgctagcaggctagcagaaatggaa
aacagcaatggatcttatctaaatgatagcatctctcctaatgagagcatagatgatgaa
catttgttaatccagcattactgccaaagtttgaaccaggactcccccctgagccagcct
cgtagtcctgcccagatcttgatttccttagagagtgaggaaagaggggagctagagaga
atcctagcagatcttgaggaagaaaacaggaatctgcaagcagaatatgaccgtctaaag
cagcagcacgaacataaaggcctgtccccactgccgtcccctcctgaaatgatgcccacc
tctccccagagtccccgggatgctgagctcattgctgaggccaagctactgcgtcaacac
aaaggccgcctggaagccaggatgcaaatcctggaagaccacaataaacagctggagtca
cagttacacaggctaaggcagctgctggagcaaccccaggcagaggccaaagtgaatggc
acaacggtgtcctctccttctacctctctacagaggtccgacagcagtcagcctatgctg
ctccgagtggttggcagtcaaacttcggactccatgggtgaggaagatcttctcagtcct
ccccaggacacaagcacagggttagaggaggtgatggagcaactcaacaactccttccct
agttcaagaggaagaaatacccctggaaagccaatgagagaggacacaatgtag

DBGET integrated database retrieval system