KEGG   Homo sapiens (human): 1806Help
Entry
1806              CDS       T01001                                 

Gene name
DPYD, DHP, DHPDHASE, DPD
Definition
dihydropyrimidine dehydrogenase (EC:1.3.1.2)
Orthology
K00207  
dihydropyrimidine dehydrogenase (NADP+) [EC:1.3.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Drug metabolism - other enzymes
Metabolic pathways
Module
Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Disease
H00193  
Dihydropyrimidine dehydrogenase deficiency
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    1806 (DPYD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    1806 (DPYD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    1806 (DPYD)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1806 (DPYD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.2  dihydropyrimidine dehydrogenase (NADP+)
     1806 (DPYD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1p22
AA seq 1025 aa AA seqDB search
MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD
DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN
PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPE
KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV
VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF
IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGG
DVVGLANTTVESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGL
KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDS
GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI
ARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS
IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NVAFSPLKRNCFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY
MTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLS
VNPVC
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgtgctcagtaaggactcggcggacatcgagagtatcctggctttaaatcct
cgaacacaaactcatgcaactctgtgttccacttcggccaagaaattagacaagaaacat
tggaaaagaaatcctgataagaactgctttaattgtgagaagctggagaataattttgat
gacatcaagcacacgactcttggtgagcgaggagctctccgagaagcaatgagatgcctg
aaatgtgcagatgccccgtgtcagaagagctgtccaactaatcttgatattaaatcattc
atcacaagtattgcaaacaagaactattatggagctgctaagatgatattttctgacaac
ccacttggtctgacttgtggaatggtatgtccaacctctgatctttgtgtaggtggatgc
aatttatatgccactgaagagggacccattaatattggtggattgcagcaatttgctact
gaggtattcaaagcaatgagtatcccacagatcagaaatccttcgctgcctcccccagaa
aaaatgtctgaagcctattctgcaaagattgctctttttggtgctgggcctgcaagtata
agttgtgcttcctttttggctcgattggggtactctgacatcactatatttgaaaaacaa
gaatatgttggtggtttaagtacttctgaaattcctcagttccggctgccgtatgatgta
gtgaattttgagattgagctaatgaaggaccttggtgtaaagataatttgcggtaaaagc
ctttcagtgaatgaaatgactcttagcactttgaaagaaaaaggctacaaagctgctttc
attggaataggtttgccagaacccaataaagatgccatcttccaaggcctgacgcaggac
caggggttttatacatccaaagactttttgccacttgtagccaaaggcagtaaagcagga
atgtgcgcctgtcactctccattgccatcgatacggggagtcgtgattgtacttggagct
ggagacactgcctttgactgtgcaacatctgctctacgttgtggagctcgccgtgtgttc
atcgtcttcagaaaaggctttgttaatataagagctgtccctgaggagatggaacttgct
aaggaagaaaagtgtgaatttctgccattcctgtccccacggaaggttatagtaaaaggt
gggagaattgttgctatgcagtttgttcggacagagcaagatgaaactggaaaatggaat
gaagatgaagatcagatggtccatctgaaagccgatgtggtcatcagtgcctttggttca
gttctgagtgatcctaaagtaaaagaagccttgagccctataaaatttaacagatggggt
ctcccagaagtagatccagaaactatgcaaactagtgaagcatgggtatttgcaggtggt
gatgtcgttggtttggctaacactacagtggaatcggtgaatgatggaaagcaagcttct
tggtacattcacaaatacgtacagtcacaatatggagcttccgtttctgccaagcctgaa
ctacccctcttttacactcctattgatctggtggacattagtgtagaaatggccggattg
aagtttataaatccttttggtcttgctagcgcaactccagccaccagcacatcaatgatt
cgaagagcttttgaagctggatggggttttgccctcaccaaaactttctctcttgataag
gacattgtgacaaatgtttcccccagaatcatccggggaaccacctctggccccatgtat
ggccctggacaaagctcctttctgaatattgagctcatcagtgagaaaacggctgcatat
tggtgtcaaagtgtcactgaactaaaggctgactttccagacaacattgtgattgctagc
attatgtgcagttacaataaaaatgactggacggaacttgccaagaagtctgaggattct
ggagcagatgccctggagttaaatttatcatgtccacatggcatgggagaaagaggaatg
ggcctggcctgtgggcaggatccagagctggtgcggaacatctgccgctgggttaggcaa
gctgttcagattcctttttttgccaagctgaccccaaatgtcactgatattgtgagcatc
gcaagagctgcaaaggaaggtggtgccaatggcgttacagccaccaacactgtctcaggt
ctgatgggattaaaatctgatggcacaccttggccagcagtggggattgcaaagcgaact
acatatggaggagtgtctgggacagcaatcagacctattgctttgagagctgtgacctcc
attgctcgtgctctgcctggatttcccattttggctactggtggaattgactctgctgaa
agtggtcttcagtttctccatagtggtgcttccgtcctccaggtatgcagtgccattcag
aatcaggatttcactgtgatcgaagactactgcactggcctcaaagccctgctttatctg
aaaagcattgaagaactacaagactgggatggacagagtccagctactgtgagtcaccag
aaagggaaaccagttccacgtatagctgaactcatggacaagaaactgccaagttttgga
ccttatctggaacagcgcaagaaaatcatagcagaaaacaagattagactgaaagaacaa
aatgtagctttttcaccacttaagagaaactgttttatccccaaaaggcctattcctacc
atcaaggatgtaataggaaaagcactgcagtaccttggaacatttggtgaattgagcaac
gtagagcaagttgtggctatgattgatgaagaaatgtgtatcaactgtggtaaatgctac
atgacctgtaatgattctggctaccaggctatacagtttgatccagaaacccacctgccc
accataaccgacacttgtacaggctgtactctgtgtctcagtgtttgccctattgtcgac
tgcatcaaaatggtttccaggacaacaccttatgaaccaaagagaggcgtacccttatct
gtgaatccggtgtgttaa

DBGET integrated database retrieval system