KEGG   Homo sapiens (human): 1811Help
Entry
1811              CDS       T01001                                 

Gene name
SLC26A3, CLD, DRA
Definition
solute carrier family 26 (anion exchanger), member 3
Orthology
K14078  
solute carrier family 26 (chloride anion exchanger), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Mineral absorption
Disease
H01174  
Congenital diarrhea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1811 (SLC26A3)
   04978 Mineral absorption
    1811 (SLC26A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
7q31
AA seq 764 aa AA seqDB search
MIEPFGNQYIVARPVYSTNAFEENHKKTGRHHKTFLDHLKVCCSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFG
TSRHISVGPFPILSMMVGLAVSGAVSKAVPDRNATTLGLPNNSNNSSLLDDERVRVAAAA
SVTVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHTDP
VSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIA
AGVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVAFAVAFSVASV
YSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAII
VLIVVLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFTI
VLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRC
PSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
IKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLD
VSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHI
LMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaccctttgggaatcagtatattgtggccaggccagtgtattctacaaatgct
tttgaggaaaatcataaaaagacaggaagacatcataagacatttctggatcatctcaaa
gtgtgttgtagctgttccccacaaaaggccaagagaattgtcctctctttgttccccata
gcatcttggttgccagcataccggcttaaagaatggttgctcagtgatattgtttctggt
atcagcacagggattgtggccgtactacaaggtttagcatttgctctgctggtcgacatt
cccccagtctatgggttgtatgcatcctttttcccagccataatctaccttttcttcggc
acttccagacacatatccgtgggtccgtttccgattctgagtatgatggtgggactagca
gtttcaggagcagtttcaaaagcagtcccagatcgcaatgcaactactttgggattgcct
aacaactcgaataattcttcactactggatgacgagagggtgagggtggcggcggcggca
tcagtcacagtgctttctggaatcatccagttggcttttgggattctgcggattggattt
gtagtgatatacctgtctgagtccctcatcagtggcttcactactgctgctgctgttcat
gttttggtttcccaactcaaattcatttttcagttgacagtcccgtcacacactgatcca
gtttcaattttcaaagtactatactctgtattctcacaaatagagaagactaatattgca
gacctggtgacagctctgattgtccttttggttgtatccattgttaaagaaataaatcag
cgcttcaaagacaaacttccagtgcccattccaatcgaattcattatgaccgtgattgca
gcaggtgtatcctacggctgtgactttaaaaacaggtttaaagtggctgtggttggggac
atgaatcctggatttcagccccctattacacctgacgtggagactttccaaaacaccgta
ggagattgcttcggcatcgcaatggttgcatttgcagtggccttttcagttgccagcgtc
tattccctcaaatacgattatccacttgatggcaatcaggagttaatagccttgggactg
ggtaacatagtctgtggagtattcagaggatttgctgggagtactgccctctccagatca
gcagttcaggagagcacaggaggcaaaacacagattgctgggcttattggtgccatcatc
gtgctgattgtcgttctagccattggatttctcctggcgcctctacaaaagtccgtcctg
gcagctttagcattgggaaacttaaagggaatgctgatgcagtttgctgaaataggcaga
ttgtggcgaaaggacaaatatgattgtttaatttggatcatgaccttcatcttcaccatt
gtcctgggactcgggttaggcctggcagctagtgtggcatttcaactgctaaccatcgtg
ttcaggacccaatttccaaaatgcagcacgctggctaatattggaagaaccaacatctat
aagaataaaaaagattattatgatatgtatgagccagaaggagtgaaaattttcagatgt
ccatctcctatctactttgcaaacattggtttctttaggcggaaacttatcgatgctgtt
ggctttagtccacttcgaattctacgcaagcgcaacaaagctttgaggaaaatccgaaaa
ctgcagaagcaaggcttgctacaagtgacaccaaaaggatttatatgtactgttgacacc
ataaaagattctgacgaagagctggacaacaatcagatagaagtactggaccagccaatc
aataccacagacctgcctttccacattgactggaatgatgatcttcctctcaacattgag
gtccccaaaatcagcctccacagcctcattcttgacttttcagcagtgtcctttcttgat
gtttcttcagtgaggggccttaaatcgattttgcaagaatttatcaggatcaaggtagat
gtgtatatcgttggaactgatgatgacttcattgagaagcttaaccggtatgaatttttt
gatggtgaagtgaaaagctcaatatttttcttaacaatccatgatgctgttttgcatatt
ttgatgaagaaagattacagtacttcaaagtttaatcccagtcaggaaaaagatggaaaa
attgattttaccataaatacaaatggaggattacgtaatcgggtatatgaggtgccagtt
gaaacaaaattctaa

DBGET integrated database retrieval system