KEGG   Homo sapiens (human): 1812Help
Entry
1812              CDS       T01001                                 

Gene name
DRD1, DADR, DRD1A
Definition
dopamine receptor D1
Orthology
K04144  
dopamine receptor D1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Drug target
Clebopride: 
Dopamine: 
Dopexamine: 
Ibopamine: 
Fenoldopam: 
Apomorphine: 
Levodopa: 
Pergolide: 
Apomorphine: 
Flupentixol: 
Clopenthixol: 
Tiotixene: 
Zuclopenthixol: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5q35.1
AA seq 446 aa AA seqDB search
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcctggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccactgcatccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccctctgatggaaatgccacttccctggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccacgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtgtgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccaacacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcatgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcagtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggtcagcacccaacctga

DBGET integrated database retrieval system