KEGG   Homo sapiens (human): 1812Help
Entry
1812              CDS       T01001                                 

Gene name
DRD1, DADR, DRD1A
Definition
dopamine receptor D1
Orthology
K04144  
dopamine receptor D1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Dopaminergic synapse
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Drug target
Clebopride: 
Dopamine: 
Dopexamine: 
Ibopamine: 
Fenoldopam: 
Apomorphine: 
Levodopa: 
Pergolide: 
Apomorphine: 
Flupentixol: 
Clopenthixol: 
Tiotixene: 
Zuclopenthixol: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1812 (DRD1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1812 (DRD1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    1812 (DRD1)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1812 (DRD1)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    1812 (DRD1)
  Substance dependence
   05030 Cocaine addiction
    1812 (DRD1)
   05031 Amphetamine addiction
    1812 (DRD1)
   05032 Morphine addiction
    1812 (DRD1)
   05034 Alcoholism
    1812 (DRD1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1812 (DRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5q35.1
AA seq 446 aa AA seqDB search
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcctggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccactgcatccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccctctgatggaaatgccacttccctggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccacgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtgtgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccaacacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcatgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcagtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggtcagcacccaacctga

DBGET integrated database retrieval system