KEGG   Homo sapiens (human): 1816Help
Entry
1816              CDS       T01001                                 

Gene name
DRD5, DBDR, DRD1B, DRD1L2
Definition
dopamine receptor D5
Orthology
K05840  
dopamine receptor D5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Dopaminergic synapse
Drug target
Dopamine: 
Dopexamine: 
Levodopa: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1816 (DRD5)
   04024 cAMP signaling pathway
    1816 (DRD5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1816 (DRD5)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1816 (DRD5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1816 (DRD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
4p16.1
AA seq 477 aa AA seqDB search
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccaggcagcaacggcaccgcgtacccggggcagttcgctctataccagcag
ctggcgcaggggaacgccgtggggggctcggcgggggcaccgccactggggccctcacag
gtggtcaccgcctgcctgctgaccctactcatcatctggaccctgctgggcaacgtgctg
gtgtgcgcagccatcgtgcggagccgccacctgcgcgccaacatgaccaacgtcttcatc
gtgtctctggccgtgtcagaccttttcgtggcgctgctggtcatgccctggaaggcagtc
gccgaggtggccggttactggccctttggagcgttctgcgacgtctgggtggccttcgac
atcatgtgctccactgcctccatcctgaacctgtgcgtcatcagcgtggaccgctactgg
gccatctccaggcccttccgctacaagcgcaagatgactcagcgcatggccttggtcatg
gtcggcctggcatggaccttgtccatcctcatctccttcattccggtccagctcaactgg
cacagggaccaggcggcctcttggggcgggctggacctgccaaacaacctggccaactgg
acgccctgggaggaggacttttgggagcccgacgtgaatgcagagaactgtgactccagc
ctgaatcgaacctacgccatctcttcctcgctcatcagcttctacatccccgttgccatc
atgatcgtgacctacacgcgcatctaccgcatcgcccaggtgcagatccgcaggatttcc
tccctggagagggccgcagagcacgcgcagagctgccggagcagcgcagcctgcgcgccc
gacaccagcctgcgcgcttccatcaagaaggagaccaaggttctcaagaccctgtcggtg
atcatgggggtcttcgtgtgttgctggctgcccttcttcatccttaactgcatggtccct
ttctgcagtggacaccccgaaggccctccggccggcttcccctgcgtcagtgagaccacc
ttcgacgtcttcgtctggttcggctgggctaactcctcactcaaccccgtcatctatgcc
ttcaacgccgactttcagaaggtgtttgcccagctgctggggtgcagccacttctgctcc
cgcacgccggtggagacggtgaacatcagcaatgagctcatctcctacaaccaagacatc
gtcttccacaaggaaatcgcagctgcctacatccacatgatgcccaacgccgttaccccc
ggcaaccgggaggtggacaacgacgaggaggagggtcctttcgatcgcatgttccagatc
tatcagacgtccccagatggtgaccctgttgctgagtctgtctgggagctggactgcgag
ggggagatttctttagacaaaataacacctttcaccccgaatggattccattaa

DBGET integrated database retrieval system