KEGG   Homo sapiens (human): 183Help
Entry
183               CDS       T01001                                 

Gene name
AGT, ANHU, SERPINA8
Definition
(RefSeq) angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
  KO
K09821  
angiotensinogen
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Renin secretion
Disease
H00575  
Renal tubular dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    183 (AGT)
   04614 Renin-angiotensin system
    183 (AGT)
  Circulatory system
   04270 Vascular smooth muscle contraction
    183 (AGT)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    183 (AGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
1q42.2
AA seq 485 aa AA seqDB search
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcgagcaccccagtctgagatggctcctgccggtgtgagcctgagggccacc
atcctctgcctcctggcctgggctggcctggctgcaggtgaccgggtgtacatacacccc
ttccacctcgtcatccacaatgagagtacctgtgagcagctggcaaaggccaatgccggg
aagcccaaagaccccaccttcatacctgctccaattcaggccaagacatcccctgtggat
gaaaaggccctacaggaccagctggtgctagtcgctgcaaaacttgacaccgaagacaag
ttgagggccgcaatggtcgggatgctggccaacttcttgggcttccgtatatatggcatg
cacagtgagctatggggcgtggtccatggggccaccgtcctctccccaacggctgtcttt
ggcaccctggcctctctctatctgggagccttggaccacacagctgacaggctacaggca
atcctgggtgttccttggaaggacaagaactgcacctcccggctggatgcgcacaaggtc
ctgtctgccctgcaggctgtacagggcctgctagtggcccagggcagggctgatagccag
gcccagctgctgctgtccacggtggtgggcgtgttcacagccccaggcctgcacctgaag
cagccgtttgtgcagggcctggctctctatacccctgtggtcctcccacgctctctggac
ttcacagaactggatgttgctgctgagaagattgacaggttcatgcaggctgtgacagga
tggaagactggctgctccctgatgggagccagtgtggacagcaccctggctttcaacacc
tacgtccacttccaagggaagatgaagggcttctccctgctggccgagccccaggagttc
tgggtggacaacagcacctcagtgtctgttcccatgctctctggcatgggcaccttccag
cactggagtgacatccaggacaacttctcggtgactcaagtgcccttcactgagagcgcc
tgcctgctgctgatccagcctcactatgcctctgacctggacaaggtggagggtctcact
ttccagcaaaactccctcaactggatgaagaaactatctccccggaccatccacctgacc
atgccccaactggtgctgcaaggatcttatgacctgcaggacctgctcgcccaggctgag
ctgcccgccattctgcacaccgagctgaacctgcaaaaattgagcaatgaccgcatcagg
gtgggggaggtgctgaacagcattttttttgagcttgaagcggatgagagagagcccaca
gagtctacccaacagcttaacaagcctgaggtcttggaggtgaccctgaaccgcccattc
ctgtttgctgtgtatgatcaaagcgccactgccctgcacttcctgggccgcgtggccaac
ccgctgagcacagcatga

DBGET integrated database retrieval system